KEGG   Nostoc sp. PCC 7120: all5295Help
Entry
all5295           CDS       T00069                                 

Definition
hypothetical protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ana  Nostoc sp. PCC 7120
Brite
Enzymes [BR:ana01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     all5295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(6318076..6319080)
Genome map
AA seq 334 aa AA seqDB search
MSSKIAFVTGATGLLGSNLCRALVSQGWQVKGLVRSLDKAKRFLGNSGIEFVQGDIEDVP
AFTQALKEVDAVFHTAAFFREYYQPGSDWQKMKRINVDATMELLQAAEAQGVAKVVFTSS
SGVIQTDTHQAATETAPYNKFAEQNLYFKTKVLAEQEIYRFLNASQIDVVMILPGWMMGP
GDAAPTSAGQLVLDLLAGKLPGVINGGAALTDVRDVAAVMVKAAEQGERGGRYIVAGPLT
TMKDIALELEAISGVKAPRIEIPDGMAIAIAWFLEKLTGLTGGVNPMPLAGIQTLLEKAK
LSSAKAERDLGATFRPLRDTLKDTVLWYESQGYL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaaatagcttttgtgactggagcaacaggtctgctgggtagtaatctttgc
cgagcgcttgtatcccagggatggcaagtaaaaggtttggttcgttctcttgataaggcc
aaacgtttcctgggaaatagtggaattgagtttgttcagggtgatattgaggatgtacct
gcctttactcaggcattaaaagaagtcgatgcggtgtttcacacggcagctttttttcgg
gagtattaccaaccgggtagtgactggcagaagatgaaacgcattaatgtagatgccaca
atggaacttctacaggcggcagaagcccaaggggtagcaaaggtggtgtttacctcatcc
agtggggtaatccaaactgatacacatcaggcagccacggaaaccgcaccttacaataaa
tttgctgaacagaatctctatttcaaaactaaggttttagcagaacaggaaatttaccgc
tttctcaacgccagccaaatagacgtagtgatgattctgcctggttggatgatggggcct
ggagatgctgcaccaacttctgccgggcaactggtgttagacctattggcaggtaaactg
cctggggtaattaatggtggtgctgcattgactgatgtacgggatgtggcggcggttatg
gtgaaagctgccgaacaaggagaaaggggtggacgttacatcgtagcggggccactaaca
accatgaaagatattgccttagaactggaagcgatttctggggtaaaagcgcctagaata
gaaattcctgatgggatggcgatcgcgatcgcttggtttttggaaaagttaacaggtttg
actggtggagtcaaccccatgccactagctggtatccagactttattggaaaaagccaag
ttaagttcagccaaagccgaacgagatttgggcgcaaccttccgccccttgagggatacg
ttgaaagatacagttctgtggtatgagtctcaaggctatctataa

DBGET integrated database retrieval system