KEGG   Nostoc sp. PCC 7120: all7071Help
Entry
all7071           CDS       T00069                                 

Definition
exodeoxyribonuclease V, alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ana00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    all7071
Enzymes [BR:ana01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     all7071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
pCC7120alpha:complement(55237..57483)
Genome map
AA seq 748 aa AA seqDB search
MSTLPTAQQSSVQPHYETITGVVERLTFHSEESGYTVARLTRSRSTDLTTIVGSFANIQP
GQTLQLTGFWKDHPQYGPQFNVTNYHETKPATLTGIEKYLGSGLIKGVGPVTARRIVAHF
GLETLDIIENQIDRLIEVQGIAKKRIKLIKNAWETQKAIKEVMVFLQTHGVSTTYAVKIY
KQYQDQAIATVTANPYQLATDIYGIGFLTADKIARNLGVPTSSEFRYSAGIIHALSEAAE
DGHCYLPQPELIEKVIKLLTTDDHQPTEDAIADIIKDMSTKEELIREFVRDSYGEKLLLC
YKPSFFHTEQNLAQLISRRLRQQVKQDIPRVRTWLDRFMSSRKIELSPQQQKAVEMAAYS
PVMVLTGGPGVGKTFTTHTIVSLWKAMSKSIALAAPTGRAAQRLSEMTGLEAKTIHRLLE
FDPKTMGFKRDNENPLPFSAIIADEASMLDLFLAHSLVKAVAQGAQLLLVGDIDQLPSVG
PGKVLADLITSLQVPVVKLTQVFRQAQQSAIVTAAHQINQGDYPNIEPISDNPQSDCLWH
GGGHSPEHGVQAICELVGEFIPRLGFNPSTDVQVLSPMSRGLVGTRNLNAVLQQLINPPA
QGKVEINRGGMVLREGDRVIQQMNDYDREVFNGDLGTILSIDTEEQEVTVEYGGRAVVYD
YADLNEITLAFSISVHKSQGGEFPVVIFPLFMQHYVMLSRNLFYTGLTRARKLAIVVGSK
KAIALAVRTTDDQQRYTRLWQRLLQSMG
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtccactctacccacagcacaacaatcatcagtacaaccccactacgaaaccatcacc
ggagtagtcgagcgcctgactttccactcagaggagtcaggctacacagtcgcacgccta
acccgctcccgcagtaccgacctgaccaccatcgtcggcagcttcgctaacatccaacca
gggcaaacgcttcagctaactggtttctggaaggatcacccccagtacgggccacagttt
aatgtcactaactaccacgaaaccaaacctgcaaccctcacagggattgagaaatacctg
ggcagtggactaatcaaaggagtcgggcctgtcacagcaagacgcattgttgcacatttc
ggtttagaaaccctcgacatcattgaaaaccaaattgaccgcctcatcgaagtacaaggt
atcgccaagaagcgcatcaagctaatcaagaatgcctgggagacgcaaaaagccatcaaa
gaggtgatggtgttcttgcaaacccacggcgtatcgactacctatgcagtcaaaatttac
aagcaatatcaggatcaggcgatcgccaccgtcaccgcgaacccgtaccagcttgccacc
gacatctacggtatcggctttctcacagccgacaagattgcgagaaacctgggcgtacca
acaagctcagagtttcgatacagtgctggaatcatccacgcattgagtgaagctgctgag
gatggtcactgttatctcccccagccggaactaatcgaaaaagttatcaaactactaaca
acagatgaccaccagccaacagaggatgcgatcgcggacatcatcaaagatatgtcaacc
aaggaagaactgatcagggaatttgtcagggacagctacggagaaaaattattactctgt
tataagccgagcttcttccacacagaacaaaacttagcacagttgatatctcgacggtta
cgccaacaagtcaaacaagacatcccccgtgtccgtacatggctagatcgctttatgtcc
agccgcaagattgagctatcaccccaacagcagaaagcagtggagatggcagcgtactca
cccgtaatggttctgactggtggccctggcgtgggcaaaactttcacgacacacacgatt
gtctcattgtggaaagcgatgagcaaaagcatcgccttggctgcaccaactgggagagcc
gcacaacgattatcggaaatgacaggacttgaagcgaaaaccattcaccgcttgctggag
tttgaccctaaaactatgggatttaagcgggataacgaaaatcccttacccttcagtgcc
attattgctgatgaagcttcgatgctggatctgtttctggcacattccctagtgaaagca
gtagcacaaggagcgcaactattactggtgggagacatcgaccaattaccctcagttggc
cctggtaaagtgttagcagatttgattacctcgctgcaagtcccggtggtcaagctaacg
caagtatttcgccaagcccagcaaagtgcgattgtcacggcagcgcatcaaatcaaccag
ggtgactatccaaatatagaaccaatctcagataatccgcagtcggactgcttgtggcat
ggtggtggccacagtcctgaacacggagtccaagcaatctgcgaattggtaggcgagttt
atcccccggctgggcttcaatccctcgactgatgtgcaggtgctatccccgatgtcgcgg
gggttagtcgggacgcgaaatcttaatgctgttttacagcagctgatcaatccgcctgca
caggggaaagtcgagattaaccggggtgggatggttttgcgggagggcgatcgcgtaatt
caacaaatgaatgactatgaccgtgaggtgttcaatggagatttggggactattctgagt
atcgacacggaggaacaagaggttacggttgagtatggtggtcgggctgtggtttatgat
tatgctgatttgaacgagataacgctggcatttagtatctctgtgcataaaagccagggc
ggagagtttccggtggtgatatttccacttttcatgcaacactatgtcatgctttcgcgg
aatttgttttacactggtttaactcgcgcaaggaagttggcgattgtggttggctctaag
aaggcgatcgctctggctgtgcgaactacagatgaccagcagaggtacacgcggttgtgg
cagaggttgttacagtcgatgggatga

DBGET integrated database retrieval system