KEGG   Nostoc sp. PCC 7120: all7335Help
Entry
all7335           CDS       T00069                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    all7335
   01230 Biosynthesis of amino acids
    all7335
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    all7335
   00030 Pentose phosphate pathway
    all7335
   00051 Fructose and mannose metabolism
    all7335
   00052 Galactose metabolism
    all7335
  Energy metabolism
   00680 Methane metabolism
    all7335
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     all7335
Protein phosphatases and associated proteins [BR:ana01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     all7335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
pCC7120alpha:complement(367820..368899)
Genome map
AA seq 359 aa AA seqDB search
MSKSRRIGILTSGGDCSGLNAVIRAVVHCASGKGWEVFGIRQATLGLMARPPQVSKLEID
QVDPLLTSGGTMLGTTNKGDPFAFPMPDGSFCDRSSEIIAGYHQLDLDALIGIGGDGSLA
ILRRLAQQGAINLVGIPKTIDNDIGITEHAIGFDTAVNIATEALDRLHFTAASHSRVMIL
EVMGRDAGHIALAAGIAGGADVILIPEILYSMDDICYHIKHRQEEGKNYCLIIVSEAVRT
QDGEILTLTNRLGQSRYGGIGEYLADQISDRIGAETRVTVLGHIQRGGIASPLDRLVASA
FGVAAVNLIEAAKYDYMVAWQNRQVITVPIEEAIAQYKAVNPEDALVKTARGLGIYLGE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaagtaggcgaataggcattcttactagtggcggggattgctctggtttgaat
gcagttatcagagctgttgttcattgtgctagcggtaaaggttgggaagtcttcggtatt
cggcaagcaactttaggattaatggcacgtccaccacaagtttctaaattagaaatcgac
caagttgatcctttattaacctctggtggcacaatgttaggaactaccaataaaggtgat
ccatttgcttttcccatgcctgatggtagtttttgtgatcgttcatcagaaattattgct
ggttatcatcaattagatttagatgcgttgattggcattggcggggatggtagtttagca
attctgcgtcgccttgcacaacaaggcgctatcaacttagtcggtatccctaaaactatt
gataatgatatcggtattactgaacacgccattggatttgatacagctgtcaatattgcc
acagaagcactcgatagattacatttcaccgccgcttctcatagtcgagtcatgatttta
gaagtcatgggtcgtgatgccggacacatcgccctcgctgcgggaattgctgggggtgca
gatgtgattttaattcccgaaattctctacagcatggatgacatttgctaccacattaaa
caccgtcaagaagaaggcaaaaactattgtttaattattgtctccgaagcagtacgaact
caagacggtgaaattctcaccctaactaatcgtttgggtcaatcacgatatggtggaatt
ggcgaatatctagccgatcaaattagcgatcgcattggtgcagaaacacgagtcacagtc
ttaggacatatccaacgcggtggtatagcttcacctctagaccgattagtcgcatctgct
tttggtgtagctgccgtcaatttgattgaggcagctaaatatgattacatggttgcttgg
caaaatcgccaagtgattactgtaccaatagaggaagctatcgctcagtacaaagccgtt
aacccagaagatgctctggtcaaaactgctcgtggtttaggtatttatttaggagagtga

DBGET integrated database retrieval system