KEGG   Nostoc sp. PCC 7120: alr0106Help
Entry
alr0106           CDS       T00069                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00230  Purine metabolism
ana01100  Metabolic pathways
Module
ana_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    alr0106
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     alr0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 AAA_22 RsgA_GTPase MMR_HSR1 AAA_29 AAA_28 ABC_tran AAA_30 AAA_14 TsaE AAA NTPase_1 cobW NACHT AAA_5 ATPase_2 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: BAB77630
CyanoBase: alr0106
CYORF: alr0106
UniProt: Q8Z0I7
Position
109372..109971
Genome map
AA seq 199 aa AA seqDB search
MMQVLSIQNCATTKENPLSGKLIILTGPSGVGKGTLMRSLLQRHPELYYSVSATTRPPRP
GEVNGESYYFVSRSKFEELIAQGEFLESAEFAGNYYGTPREAVLNQVQSGKLVVLEIELA
GARQIRTSFPEALSIFILPPSFEELENRIRGRGQDSEEAIARRLQRAKEEIQAADEFDIQ
IVNDDFEAALQAIEVALFG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagttttatccatccagaattgtgctactaccaaagaaaatccgttgtcaggc
aagctgattattttaaccgggcctagtggggtcggtaaaggtactttaatgcgatcgctc
cttcagcgtcatccggaactttattactctgtatctgcaacaacccgtcctccccgtcct
ggggaagtaaatggcgaaagctattactttgttagccgcagtaagtttgaagaattaatt
gctcaaggtgaatttcttgaatcggcagaatttgcgggtaattattatggcactcctcgt
gaagccgtactgaaccaagttcaatctggtaagttagttgtgctggaaattgaattagca
ggagcaagacaaatccgtacctctttccctgaagctctgagtatttttattctgccgcct
tcctttgaagagttggaaaaccgaattcgggggcgtggacaggactcagaggaagcgatc
gcccgtcgcttacaacgtgccaaagaagagattcaagctgcggatgaatttgatattcaa
attgtgaatgacgattttgaagccgcactccaggcgatcgaagtagccttatttggataa

DBGET integrated database retrieval system