KEGG   Anabaena sp. PCC7120: alr0106Help
Entry
alr0106           CDS       T00069                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ana  Anabaena sp. PCC7120
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ana00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
109372..109971
Genome map
AA seq 199 aa AA seqDB search
MMQVLSIQNCATTKENPLSGKLIILTGPSGVGKGTLMRSLLQRHPELYYSVSATTRPPRP
GEVNGESYYFVSRSKFEELIAQGEFLESAEFAGNYYGTPREAVLNQVQSGKLVVLEIELA
GARQIRTSFPEALSIFILPPSFEELENRIRGRGQDSEEAIARRLQRAKEEIQAADEFDIQ
IVNDDFEAALQAIEVALFG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagttttatccatccagaattgtgctactaccaaagaaaatccgttgtcaggc
aagctgattattttaaccgggcctagtggggtcggtaaaggtactttaatgcgatcgctc
cttcagcgtcatccggaactttattactctgtatctgcaacaacccgtcctccccgtcct
ggggaagtaaatggcgaaagctattactttgttagccgcagtaagtttgaagaattaatt
gctcaaggtgaatttcttgaatcggcagaatttgcgggtaattattatggcactcctcgt
gaagccgtactgaaccaagttcaatctggtaagttagttgtgctggaaattgaattagca
ggagcaagacaaatccgtacctctttccctgaagctctgagtatttttattctgccgcct
tcctttgaagagttggaaaaccgaattcgggggcgtggacaggactcagaggaagcgatc
gcccgtcgcttacaacgtgccaaagaagagattcaagctgcggatgaatttgatattcaa
attgtgaatgacgattttgaagccgcactccaggcgatcgaagtagccttatttggataa

DBGET integrated database retrieval system