KEGG   Nostoc sp. PCC 7120: alr0169Help
Entry
alr0169           CDS       T00069                                 

Definition
cyclomaltodextrin glucanotransferase
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
ana  Nostoc sp. PCC 7120
Brite
Enzymes [BR:ana01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.19  cyclomaltodextrin glucanotransferase
     alr0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
177701..179629
Genome map
AA seq 642 aa AA seqDB search
MVQTPPSQFSEEQYKIENANAEVQALIESPTPETEIDLEFLYTRDIEFRQETIYFLVVDR
FYDGDPENSEGYNPELYDPNGEDWGKYWGGDLQGVIDKLDYLKDMGVTALWLTPLFEQVE
ELFVGNAAMHGYWTKDFKRLNPRYIGKDENPSLNNTQETRNTTFDRLVTELHKRKMKLIL
DIVCNHSSPDTSGSKGELYDDGVKIADFNNDVNHWYHHYGEVEDWEDDWQVQNCELSGLA
TFNENNTEYRQYIKLAIKQWLDRGVDALRVDTVKHMPIWFWQEFTGDMYNHKPDVFIFGE
WIYNHPSDDLSVEFANNSGMTLLDFGLCVAIRGALAQGAEGGFHLIQEVFDQDYRYNGAT
ELITFVDNHDMPRFQSLNPDPAMLKVAIALIMTSRGIPCIYYGTEQYLHDDTNGGNDPYN
RPMMGNWDTDTEVYRYLRLLSGIRRLNPAISMGSQWQKYLTSDVYCYVRRYRSSVCFVAL
NRGAELILPEVQTDLPDGEHTCAVTRNKFEVKDGKIYNLQLEERGVMVLSHVGERVKAQT
IVRVQLNGVHTQPGETIVVVGDCPELGNWDISKAYPLEYINSNTWFAEIPFDESAGKLIS
YKYAMWREGRSPLRENILNRRWVVAKEGTVKWRDTWASGRES
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaacaccaccatcacaattttccgaagaacaatacaaaatcgaaaatgctaat
gcagaggtacaagcattaatcgaatcacctacgccagagacagaaatagatttagaattt
ctctacactagggatattgaatttcgccaagaaactatttactttctagtagttgatcgc
ttttatgatggcgaccctgaaaatagcgaaggctataatccagaactttatgacccaaat
ggagaagattggggtaagtattggggaggcgacttacaaggagttattgataaattagac
tatctaaaagatatgggagtaaccgcactttggttaactcctttatttgaacaagtcgaa
gaattatttgttggtaacgccgccatgcacggctattggacaaaagattttaaacggctg
aatccccgctacattggtaaggatgaaaatccttctttaaacaatactcaagaaaccaga
aatactacttttgaccgcttagttacagaattacacaagcggaaaatgaagctcatactt
gatatcgtctgcaaccatagcagtcctgatactagtggtagcaaaggcgaattatatgat
gatggggtaaaaatcgccgactttaataatgatgtgaatcattggtatcatcactatggt
gaagttgaagattgggaagatgattggcaagtccaaaactgtgaactttcaggactggca
acttttaacgaaaacaatactgaatatcgtcaatacatcaagttggcaattaagcaatgg
ctagaccggggtgtggatgcactgcgggtagatacagtcaaacatatgccgatttggttt
tggcaagaatttactggtgatatgtataatcacaaaccagatgtgtttatttttggtgag
tggatttacaatcatcccagtgacgatctttcggtggaatttgccaataattccggcatg
actttacttgattttggtctgtgcgtagcaattcgcggcgcactagcccaaggcgcagaa
gggggattccacctcatccaagaagtatttgaccaagattatcgctacaacggagctaca
gagttaatcacctttgttgataaccatgatatgccccgctttcaatccctcaatcctgat
ccggcgatgttgaaagtagcgatcgccctgattatgacatcacggggtattccatgtatc
tattacggtacagaacaatatctgcatgatgatactaacggcggtaatgacccctataac
cgccccatgatgggaaattgggatactgatactgaggtgtatagatacctccgattgttg
tctggtatccggcggttaaatccagccatctctatgggtagccagtggcaaaaatacctc
acatctgatgtttactgttatgtccgccgttatcgttcttctgtttgcttcgtcgccctc
aaccggggtgcagaactcatcttaccagaagtccaaacagacttaccagatggtgaacat
acttgcgccgtgactcggaataaatttgaggtaaaagacggtaagatttacaatctgcaa
ctcgaagaacggggagtcatggttttaagtcatgtaggtgaacgggtaaaagcgcaaaca
atagtccgcgttcaacttaatggtgtacatactcaacccggtgaaactatcgtagttgtc
ggcgactgtccagaattgggtaactgggatattagtaaagcctatcccctggaatacatc
aactctaatacttggtttgccgaaataccatttgatgaaagcgcaggtaaactcatcagt
tataaatatgccatgtggcgtgaagggcgatcgcctctgcgagaaaatatcttaaatcgt
cgttgggtagtggcgaaggaaggcacagttaaatggcgtgatacttgggcttctgggaga
gaatcttaa

DBGET integrated database retrieval system