KEGG   Nostoc sp. PCC 7120: alr0612Help
Entry
alr0612           CDS       T00069                                 

Gene name
narB
Definition
(GenBank) nitrate reductase
  KO
K00367  
ferredoxin-nitrate reductase [EC:1.7.7.2]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Assimilatory nitrate reduction, nitrate => ammonia
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    alr0612 (narB)
Enzymes [BR:ana01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.7  With an iron-sulfur protein as acceptor
    1.7.7.2  ferredoxin---nitrate reductase
     alr0612 (narB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
711707..713947
Genome map
AA seq 746 aa AA seqDB search
MTESTKTLCPYCGVGCGLEVTPPAQLNKATNRDSQGNPTWRVRGDKAHPSSQGMVCVKGA
TIAESLDKNRLHYPMVRESLDQEFRRVSWDEAFDLITKRIQSVRFTQGAEAICMYGSGQF
QTEDYYIAQKLMKGCLGSNNFDANSRLCMSSAVSGYIQSFGADGPPCCYEDLELTDCAFL
IGTNTAECHPIVFNRLEKYHRKNHKVKMIVVDPRRTPTAEAADLHLAIKPGTDIDLLNGI
AHLLMRWNMIDVGFIDDCTRNFSAYAEVIRHYSPEVVARQCGITIEDLETASRYWGESQR
VLSLWSMGVNQSSEGTAKVRTIINLHLMTGQVGKPGAGPFSLTGQPNAMGGREAGGLAHL
LPGYRLVKNPQHRAELEAFWGFQPGQISPHPGLTAWDMITGLEDGNVGLLWIAATNPAVS
MPDLERTKKALLRSPFTIYQDAYHPTETTAYAHVLLPAAQWGEKTGIMTNSERRVTLCQA
FRQPPREAKPDWEIFAEVGRRLGFEDKFAFTNSAQVYAEFTQLTKGRPCDMSGISHQQLQ
AQGPTQWPHSSINIETQKPTQHPTVNSQQSTVTSQQSKRLYTDLRFHTPDGRARFGAYYS
KGLAEPPDPSYPFVLTTGRLYGHWHTQTRTGRIEKIRAMHPEPFIEIHPRDAAKLGITDN
VVVEVRSRRGSAKFPAKVTKAISPGTVFVPMHWGKLWADDAEANALTHSESCPDSLQPEL
KACAVQLIPISVENTAQNYQLQSSQW
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaatctaccaaaaccctatgtccttattgtggtgtcggctgtggactagaagta
acaccacccgcccaactcaacaaagccacaaatcgagatagccaaggaaatccaacttgg
cgggtgcggggtgataaagcccatccatctagccagggtatggtttgtgtcaaaggggca
acgatcgccgaatctttggataaaaatagattacattacccaatggtacgggaatcactt
gatcaagagttccgccgtgtcagttgggatgaagcttttgacctcatcaccaagcgtatt
caatctgtgcgctttacccagggggcggaagctatatgtatgtatggttccggtcaattc
caaacggaggattactacatagcccaaaaactgatgaaaggttgtttgggtagcaataat
tttgatgctaactctcggctatgtatgtctagtgcggtctctgggtatattcaaagtttt
ggggctgatgggcctccctgctgctatgaagatttggagttaactgactgtgcattttta
attgggacaaataccgccgaatgtcacccgattgtttttaaccgcctggagaagtaccac
agaaaaaaccataaggtaaaaatgattgtggttgatcctcgacgcacacccacagccgaa
gcagctgatttacatttggcgattaaaccgggtacagatattgacttgttaaatggaatt
gctcatttgttaatgcgttggaacatgatagatgtcggtttcatcgatgactgtaccaga
aacttttcggcttacgctgaggtaattcgccactattcgccggaggtagtagctcgtcaa
tgtggtatcaccatcgaagatttagaaaccgcctcccgttattggggtgaatcgcagcgt
gtgttgtccttatggtcgatgggtgtaaatcaatcaagtgaaggtacagccaaagtcaga
acgattattaacctgcatttgatgacgggacaagtcggaaaaccaggggctgggcctttc
tctctcactggtcaaccgaatgcaatgggaggaagggaagcaggcggtttagctcattta
ttaccgggttatcgattggtgaaaaatccccaacaccgggcagaattagaagcattttgg
ggattccagccagggcaaatttcaccccatcctggtttaactgcatgggacatgatcact
ggcttggaagacggtaacgtgggtttactgtggattgcggctactaacccagctgtaagt
atgccagatttggaacggacgaaaaaggcattattgcgatcgcctttcaccatctaccaa
gatgcttaccaccccacagaaactacagcttatgcccatgtcttgttaccagcagcccag
tggggtgaaaaaactggtatcatgactaactcagaacgtcgagttaccctatgtcaagcc
ttccgccaaccaccacgagaagctaaaccagattgggaaatcttcgcagaagtgggacgc
agattaggttttgaggacaagttcgcctttactaactcagcccaagtatacgccgagttt
acccaactgaccaagggtcgcccttgtgatatgtctggtatcagccatcaacaattgcaa
gcccaaggccccactcaatggccccactcctctataaatatcgaaacacaaaaaccaact
caacacccaacagtcaacagtcaacagtcaacagtcaccagtcaacagtcaaaaagactc
tacactgatttacgttttcatacccctgatggtcgcgctcgatttggcgcatattattct
aagggattagcagaaccaccagaccctagttatccttttgtgttgactactggacgatta
tacggacattggcacacccaaacccgtactggtcgcattgaaaaaatccgcgccatgcac
cccgaaccatttatcgaaattcatcctcgtgatgcggcgaagttaggcattactgataat
gtggtggtggaagtgcgatcgcgtcgaggtagcgccaagtttcccgccaaggtgacaaaa
gctatttccccaggtacagtttttgtgcctatgcactggggtaaactctgggcagatgac
gcagaagctaacgccctcacccattcagaatcttgccccgattcactgcaaccagaatta
aaagcctgtgcagtccaattaataccaatctccgtagaaaacacagcccaaaattatcaa
ctccagtcatctcagtggtaa

DBGET integrated database retrieval system