KEGG   Nostoc sp. PCC 7120: alr1167Help
Entry
alr1167           CDS       T00069                                 

Definition
lysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ana  Nostoc sp. PCC 7120
Brite
Enzymes [BR:ana01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     alr1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1369858..1370586
Genome map
AA seq 242 aa AA seqDB search
MSITETLRKGSKGSDVSELQEILIKLKFDPGRIDGDFGNKTEAAVKQFQQRQSITPDGVV
EINTRNALNKAIQRQIEIAKLYGGASGKLPLPGVNLIKEFEGCKLIAYPDPLSKGKPYTI
GWGSTVKKDGSEWSLGEKMTQVEADELLILQLERKYLPSLEKIPGWENLNPYQQGALLSF
AYNLGANFYGSKGFETITRVLNNQEWDKIEPTLTMYRNPGSSVEAGLRRRRVAEAKLFLQ
PL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcaccgagacgctcagaaaagggtcaaaaggctcagatgtgagcgaactgcaa
gaaatattaattaaactaaaattcgacccaggtcggatagatggtgatttcggtaacaaa
acagaagcggctgtcaaacaattccagcaaaggcaaagtattactcctgatggcgtagta
gagataaatactcgtaatgccttaaataaagcaattcagaggcaaatagaaatagcaaaa
ctttatggtggggcttccggtaaattaccactaccaggggtgaatttgatcaaggaattt
gaaggttgtaagctgatagcttatccagatcccctctctaaaggtaaaccttacaccatt
ggttggggttctaccgtcaaaaaagatggtagcgaatggtcgttgggtgaaaaaatgacc
caagtggaggcggatgaactgttaattcttcagttagagcgtaaatatttaccatctcta
gagaaaatacccggatgggaaaatttaaatccttaccaacaaggagcattattaagtttt
gcctataacttgggtgcgaatttctacggttctaagggctttgagacaattactagagtt
ttgaacaatcaagagtgggacaaaattgaacccacactaactatgtatagaaatccgggt
agttcagttgaggcgggtttgaggcgcaggcgagtagctgaggctaaactatttcttcag
ccattgtaa

DBGET integrated database retrieval system