KEGG   Nostoc sp. PCC 7120: alr1586Help
Entry
alr1586           CDS       T00069                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    alr1586
Enzymes [BR:ana01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     alr1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1855846..1858332
Genome map
AA seq 828 aa AA seqDB search
MKRWLLVNLIALCSVLFLGTNAAWAVGGGIAPGAPGVSSVWSYAGKQGIGTSYEQYVNNK
YSDRAPTNAISKVWFSIAQGIVTETAYGEIDRAQINDLQFLVTGKGFFDEEKVATESKVD
YLDKDSDGRPLSPAYRVINTDKEGKYTIEKHIFTDPDHQTLFTKVIFTANEDNITPYILI
NPHMNNTGKEDVAFVKSDSLNAREGEIVYLSLKSSLPFVKTSAGYVARSDGYQDLKDNGV
MDWTYDYTDQSKPGSVAMIGQLPALSKGQTSTFNIAVGFGSTYEAATEQADASLKEGYES
LLAKYNGKGNAVGWEDYLASLSNLPAMIANTGDKGKQLYASAFTLKSMEDKENPGALIAS
LSVPWGDTVNADTFATGYRAVWPRDFYQAAMALLALGDKETPLTAFKYLPQVQVQSDTLG
NSGATGWFLQKTHVDGTLEWLGVQLDQTAMPIMLGWKLWKAGVLSDGEITQQYRTMLKPA
AEFLANGGNVNIHTSNQANNRKINPPSTHQERWEEQSGYSPSTTAAIITGLVAAADIAEN
AADDPGAAAFYFSKADEYQKNVDKFMFTTTGDVKNCNGSSEYLLRVTPNADPNDGSRIHD
NNSLLEADERQILDGGFLELVRYGVRKGDDAHIAASVCALDNINLSEALRVRYDIAFDGK
KYPGFRRYGNDGYGEQINDGSNFRDIDDGQKKDRRGRIWPFFTGERGHYELELAKAKHGG
TISDQEVAKLRDTYVRAMEYFANESLMLPEQVWDGVGANTAHKYITGEGTNSATPLAWAH
AEYIKLVKSLTDKNVWDSYPIVQARYQSSESLSALSSHPNDTKISANP
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttggttgttagttaacttaattgctctttgctcggttttgttcttaggaaca
aacgctgcttgggcagtcggcggtggtattgcaccaggcgcaccgggtgtttcctctgtt
tggtcttatgctggaaagcaaggcattggaacatcctatgaacagtatgtgaataacaaa
tatagcgatcgcgctcctacaaatgccatctccaaggtttggttttcgattgctcaaggc
attgtgacggaaaccgcttatggagaaatcgatcgcgcccagatcaacgacttacaattt
ttagtcacaggaaaaggtttttttgacgaagagaaggttgctaccgaaagcaaggtggac
tatctagataaagatagtgatggtagaccgctttctcccgcttatcgtgtcatcaatacg
gataaagaaggcaaatacactattgaaaagcacatctttaccgatcctgatcaccaaacc
ttgtttacaaaagtgatctttactgcgaatgaggataacattaccccctacattctcatc
aatcctcacatgaataatactggcaaagaagatgtagcttttgtcaaaagcgatagtctc
aatgctagggaaggagaaattgtttatctcagtttgaagagttcattaccttttgtgaaa
acctcagctggatatgtagctcgtagtgacggctatcaagatttaaaagacaacggggtg
atggactggacttatgactacactgatcagagcaagccggggagtgtagctatgataggt
caactgcctgccctcagtaaaggacaaacttccacctttaatattgctgtaggctttggc
agcacctatgaagcagcaactgaacaagccgatgcttctttaaaagaaggttacgaaagt
ctgttagcaaaatacaacggcaaaggcaacgctgtaggatgggaagattatctagcaagt
cttagcaatctgccggccatgattgccaacactggtgacaaggggaaacagctatatgct
agtgctttcaccctcaaaagtatggaagataaagaaaatccaggggctttaattgcttct
ttatccgttccttggggagatactgtgaacgcagacacctttgccacaggctatcgagcg
gtttggccgagagacttttatcaagcggcgatggcgttgttagctttaggagataaagaa
actcctttaacggcttttaaatacctcccacaagtacaagtgcaatcagatacactaggt
aactctggggctacaggctggtttttacaaaaaactcacgttgatggaaccttggaatgg
ctgggagtgcagttagatcaaactgctatgcccattatgttgggttggaaattgtggaaa
gccggagtcttgtcggatggtgaaatcactcagcaatatcgcacgatgttgaaacctgcc
gcagaatttctggctaatggcggtaatgtcaatatacatacctctaatcaagcaaacaac
cgcaagataaatccaccaagcactcatcaagaacgatgggaagaacaatcaggatattcc
ccctctacaacggctgcgattattactgggttagttgcggcagctgatattgctgaaaat
gcagctgatgatcctggtgcagccgcattctatttcagtaaagcagatgaatatcaaaag
aatgtggataaatttatgtttaccacaactggagatgttaagaactgtaatggctctagt
gaatatcttctgagagttacccctaatgcagatcctaacgatggaagtcgcatccacgac
aacaatagtttactagaagcggatgaacgccagattttagatggtggtttcttggaactg
gtacgttatggagtcagaaaaggagatgatgctcacattgctgccagtgtttgcgccttg
gataatatcaacctctcagaagctttaagggttaggtatgacatagcttttgatggtaaa
aagtatccaggattccgacgttatggcaatgatggctatggtgaacaaatcaacgatggt
agtaactttcgggatattgatgacggacagaaaaaagatcgcagaggaaggatttggccg
ttcttcactggtgaacgtggtcattatgaacttgagttagctaaagctaaacatggagga
actattagcgatcaagaggttgctaaactacgggatacttatgtacgagcaatggaatat
tttgctaacgaaagtctcatgcttcctgaacaagtgtgggatggtgttggtgctaatact
gctcataaatacatcactggtgaaggaacgaatagcgccacacctttagcttgggcgcac
gccgaatatatcaagttagtcaaatctttgactgataagaatgtttgggattcctacccc
attgttcaggcaagataccaatcttccgaatctctgagtgcattaagctctcatccgaat
gacacgaagataagtgcaaatccttaa

DBGET integrated database retrieval system