KEGG   Anabaena sp. PCC7120: alr1586Help
Entry
alr1586           CDS       T00069                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ana  Anabaena sp. PCC7120
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ana00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1855846..1858332
Genome map
AA seq 828 aa AA seqDB search
MKRWLLVNLIALCSVLFLGTNAAWAVGGGIAPGAPGVSSVWSYAGKQGIGTSYEQYVNNK
YSDRAPTNAISKVWFSIAQGIVTETAYGEIDRAQINDLQFLVTGKGFFDEEKVATESKVD
YLDKDSDGRPLSPAYRVINTDKEGKYTIEKHIFTDPDHQTLFTKVIFTANEDNITPYILI
NPHMNNTGKEDVAFVKSDSLNAREGEIVYLSLKSSLPFVKTSAGYVARSDGYQDLKDNGV
MDWTYDYTDQSKPGSVAMIGQLPALSKGQTSTFNIAVGFGSTYEAATEQADASLKEGYES
LLAKYNGKGNAVGWEDYLASLSNLPAMIANTGDKGKQLYASAFTLKSMEDKENPGALIAS
LSVPWGDTVNADTFATGYRAVWPRDFYQAAMALLALGDKETPLTAFKYLPQVQVQSDTLG
NSGATGWFLQKTHVDGTLEWLGVQLDQTAMPIMLGWKLWKAGVLSDGEITQQYRTMLKPA
AEFLANGGNVNIHTSNQANNRKINPPSTHQERWEEQSGYSPSTTAAIITGLVAAADIAEN
AADDPGAAAFYFSKADEYQKNVDKFMFTTTGDVKNCNGSSEYLLRVTPNADPNDGSRIHD
NNSLLEADERQILDGGFLELVRYGVRKGDDAHIAASVCALDNINLSEALRVRYDIAFDGK
KYPGFRRYGNDGYGEQINDGSNFRDIDDGQKKDRRGRIWPFFTGERGHYELELAKAKHGG
TISDQEVAKLRDTYVRAMEYFANESLMLPEQVWDGVGANTAHKYITGEGTNSATPLAWAH
AEYIKLVKSLTDKNVWDSYPIVQARYQSSESLSALSSHPNDTKISANP
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttggttgttagttaacttaattgctctttgctcggttttgttcttaggaaca
aacgctgcttgggcagtcggcggtggtattgcaccaggcgcaccgggtgtttcctctgtt
tggtcttatgctggaaagcaaggcattggaacatcctatgaacagtatgtgaataacaaa
tatagcgatcgcgctcctacaaatgccatctccaaggtttggttttcgattgctcaaggc
attgtgacggaaaccgcttatggagaaatcgatcgcgcccagatcaacgacttacaattt
ttagtcacaggaaaaggtttttttgacgaagagaaggttgctaccgaaagcaaggtggac
tatctagataaagatagtgatggtagaccgctttctcccgcttatcgtgtcatcaatacg
gataaagaaggcaaatacactattgaaaagcacatctttaccgatcctgatcaccaaacc
ttgtttacaaaagtgatctttactgcgaatgaggataacattaccccctacattctcatc
aatcctcacatgaataatactggcaaagaagatgtagcttttgtcaaaagcgatagtctc
aatgctagggaaggagaaattgtttatctcagtttgaagagttcattaccttttgtgaaa
acctcagctggatatgtagctcgtagtgacggctatcaagatttaaaagacaacggggtg
atggactggacttatgactacactgatcagagcaagccggggagtgtagctatgataggt
caactgcctgccctcagtaaaggacaaacttccacctttaatattgctgtaggctttggc
agcacctatgaagcagcaactgaacaagccgatgcttctttaaaagaaggttacgaaagt
ctgttagcaaaatacaacggcaaaggcaacgctgtaggatgggaagattatctagcaagt
cttagcaatctgccggccatgattgccaacactggtgacaaggggaaacagctatatgct
agtgctttcaccctcaaaagtatggaagataaagaaaatccaggggctttaattgcttct
ttatccgttccttggggagatactgtgaacgcagacacctttgccacaggctatcgagcg
gtttggccgagagacttttatcaagcggcgatggcgttgttagctttaggagataaagaa
actcctttaacggcttttaaatacctcccacaagtacaagtgcaatcagatacactaggt
aactctggggctacaggctggtttttacaaaaaactcacgttgatggaaccttggaatgg
ctgggagtgcagttagatcaaactgctatgcccattatgttgggttggaaattgtggaaa
gccggagtcttgtcggatggtgaaatcactcagcaatatcgcacgatgttgaaacctgcc
gcagaatttctggctaatggcggtaatgtcaatatacatacctctaatcaagcaaacaac
cgcaagataaatccaccaagcactcatcaagaacgatgggaagaacaatcaggatattcc
ccctctacaacggctgcgattattactgggttagttgcggcagctgatattgctgaaaat
gcagctgatgatcctggtgcagccgcattctatttcagtaaagcagatgaatatcaaaag
aatgtggataaatttatgtttaccacaactggagatgttaagaactgtaatggctctagt
gaatatcttctgagagttacccctaatgcagatcctaacgatggaagtcgcatccacgac
aacaatagtttactagaagcggatgaacgccagattttagatggtggtttcttggaactg
gtacgttatggagtcagaaaaggagatgatgctcacattgctgccagtgtttgcgccttg
gataatatcaacctctcagaagctttaagggttaggtatgacatagcttttgatggtaaa
aagtatccaggattccgacgttatggcaatgatggctatggtgaacaaatcaacgatggt
agtaactttcgggatattgatgacggacagaaaaaagatcgcagaggaaggatttggccg
ttcttcactggtgaacgtggtcattatgaacttgagttagctaaagctaaacatggagga
actattagcgatcaagaggttgctaaactacgggatacttatgtacgagcaatggaatat
tttgctaacgaaagtctcatgcttcctgaacaagtgtgggatggtgttggtgctaatact
gctcataaatacatcactggtgaaggaacgaatagcgccacacctttagcttgggcgcac
gccgaatatatcaagttagtcaaatctttgactgataagaatgtttgggattcctacccc
attgttcaggcaagataccaatcttccgaatctctgagtgcattaagctctcatccgaat
gacacgaagataagtgcaaatccttaa

DBGET integrated database retrieval system