KEGG   Nostoc sp. PCC 7120: alr1913Help
Entry
alr1913           CDS       T00069                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    alr1913 (pfkA)
   01230 Biosynthesis of amino acids
    alr1913 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    alr1913 (pfkA)
   00030 Pentose phosphate pathway
    alr1913 (pfkA)
   00051 Fructose and mannose metabolism
    alr1913 (pfkA)
   00052 Galactose metabolism
    alr1913 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    alr1913 (pfkA)
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     alr1913 (pfkA)
Protein phosphatases and associated proteins [BR:ana01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     alr1913 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2293110..2294183
Genome map
AA seq 357 aa AA seqDB search
MRKRIGILTSGGDCPGLNCVIRAVVSHATLTYDWEVLGIPYATQGLRERQAIALNMHGWD
LRGIDPLLNMGGTILGTINKGDTLAHVDEMLASYQALALDALIVIGGDGSLGILHELASR
GNWNLVAIPKTIDNDVALTERAVGFDTAVNTIVDALNRLTFTAASHDRVMIVEVMGRSAG
HLALHAGIAGGADVILIPEISYTISGLCQHIAELRDRWQRKFAIVVVAEGAKLCLEDVQE
NIASSCAPSKCGRGQYIADQIAQCSKNLIDTRVSVLGHIQRGGIPSALDRLTATVFGKTA
VDLIAQGKFGQMVAWQNGEAIPVPIQDVVAQSPLHVNPQGSLVQSARCLGIYVGEKT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacgaattggtatcctcaccagtggcggcgactgtccagggcttaactgcgta
attcgcgcagttgttagccatgcaacgcttacttatgattgggaggtattgggtatacct
tatgccactcagggtttacgggagcgtcaagcgatcgctctcaatatgcacggttgggat
ttgcgcggtatcgatcctctgctgaatatgggtggtacgattttaggcacaattaataag
ggtgataccttagcccatgtggatgaaatgcttgccagttatcaggctttggctttggat
gctttgattgtcattggcggtgatggtagtctgggtatcctccatgaactggctagccga
ggtaattggaatttagtggcgattcccaaaactatagataatgatgtggctttgacagaa
cgcgccgtgggttttgatacggcggtgaatacaattgttgatgccctcaatcgcttgact
tttacggctgcaagtcacgatcgcgtgatgattgtcgaagttatggggcgcagcgccgga
catctagccctacacgcgggtattgctggcggtgcagatgtaattttaatccccgaaatt
tcatacacaattagcggtttatgtcaacatatagctgaattgcgcgatcgctggcaacgc
aaatttgcgatcgttgttgttgccgaaggtgcgaaactatgtctggaagatgtgcaagaa
aatattgcctcttcttgtgcgccttctaaatgcggtcgcggtcaatatattgcggatcaa
attgctcaatgtagtaaaaatctcatcgataccagagtttctgtattgggacacattcag
cgtggcggtatcccatcagctttagaccgtttaacagcaacagtttttgggaaaacagcc
gttgatttaatagctcaaggtaaatttgggcagatggtagcttggcaaaatggcgaagct
atcccagtacccattcaggacgttgtcgctcaaagtcctttacacgtaaatccccaaggt
tctttggtacagagcgctcgttgtttgggtatttatgtaggagaaaaaacataa

DBGET integrated database retrieval system