KEGG   Nostoc sp. PCC 7120: alr1913Help
Entry
alr1913           CDS       T00069                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00010  Glycolysis / Gluconeogenesis
ana00030  Pentose phosphate pathway
ana00051  Fructose and mannose metabolism
ana00052  Galactose metabolism
ana00680  Methane metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01120  Microbial metabolism in diverse environments
ana01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    alr1913
   00030 Pentose phosphate pathway
    alr1913
   00051 Fructose and mannose metabolism
    alr1913
   00052 Galactose metabolism
    alr1913
  Energy metabolism
   00680 Methane metabolism
    alr1913
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     alr1913
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     alr1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: BAB73612
CyanoBase: alr1913
CYORF: alr1913
UniProt: Q8YVR1
Position
2293110..2294183
Genome map
AA seq 357 aa AA seqDB search
MRKRIGILTSGGDCPGLNCVIRAVVSHATLTYDWEVLGIPYATQGLRERQAIALNMHGWD
LRGIDPLLNMGGTILGTINKGDTLAHVDEMLASYQALALDALIVIGGDGSLGILHELASR
GNWNLVAIPKTIDNDVALTERAVGFDTAVNTIVDALNRLTFTAASHDRVMIVEVMGRSAG
HLALHAGIAGGADVILIPEISYTISGLCQHIAELRDRWQRKFAIVVVAEGAKLCLEDVQE
NIASSCAPSKCGRGQYIADQIAQCSKNLIDTRVSVLGHIQRGGIPSALDRLTATVFGKTA
VDLIAQGKFGQMVAWQNGEAIPVPIQDVVAQSPLHVNPQGSLVQSARCLGIYVGEKT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacgaattggtatcctcaccagtggcggcgactgtccagggcttaactgcgta
attcgcgcagttgttagccatgcaacgcttacttatgattgggaggtattgggtatacct
tatgccactcagggtttacgggagcgtcaagcgatcgctctcaatatgcacggttgggat
ttgcgcggtatcgatcctctgctgaatatgggtggtacgattttaggcacaattaataag
ggtgataccttagcccatgtggatgaaatgcttgccagttatcaggctttggctttggat
gctttgattgtcattggcggtgatggtagtctgggtatcctccatgaactggctagccga
ggtaattggaatttagtggcgattcccaaaactatagataatgatgtggctttgacagaa
cgcgccgtgggttttgatacggcggtgaatacaattgttgatgccctcaatcgcttgact
tttacggctgcaagtcacgatcgcgtgatgattgtcgaagttatggggcgcagcgccgga
catctagccctacacgcgggtattgctggcggtgcagatgtaattttaatccccgaaatt
tcatacacaattagcggtttatgtcaacatatagctgaattgcgcgatcgctggcaacgc
aaatttgcgatcgttgttgttgccgaaggtgcgaaactatgtctggaagatgtgcaagaa
aatattgcctcttcttgtgcgccttctaaatgcggtcgcggtcaatatattgcggatcaa
attgctcaatgtagtaaaaatctcatcgataccagagtttctgtattgggacacattcag
cgtggcggtatcccatcagctttagaccgtttaacagcaacagtttttgggaaaacagcc
gttgatttaatagctcaaggtaaatttgggcagatggtagcttggcaaaatggcgaagct
atcccagtacccattcaggacgttgtcgctcaaagtcctttacacgtaaatccccaaggt
tctttggtacagagcgctcgttgtttgggtatttatgtaggagaaaaaacataa

DBGET integrated database retrieval system