KEGG   Anabaena sp. PCC7120: alr2310Help
Entry
alr2310           CDS       T00069                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ana  Anabaena sp. PCC7120
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ana00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2783871..2784911
Genome map
AA seq 346 aa AA seqDB search
MINQLQDYNPSGVGEINGNLLGLPCDYDSANLIVFAVPWEVTVSYGAGTANGPQRILDAS
VQLDLFDFDHPDGWKQGIFLVEIPQEMIEKNNYYRDLAAQIIERLAQGKLLTDTPDLTPV
LTEINQASQQVNQWLFTQCQAAMSQGKQVAVIGGDHSSPLGYFQALAAKYSNFGILHIDA
HADLRDAYEGFEFSHASIMFNGLKLPQISKLVQVGLRDISHDEVRMIEESHGRIVAYYDP
MIKQKLYGETNWIELSREIVNHLPEYVHISFDVDGLDPKLCPNTGTPVPGGLELEQVFCL
FRELVNSGRKIIGFDVCEVGDAEWDGNVGARVVYKLANLMDLSHKQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgattaatcaactccaagactataaccctagcggcgtaggtgaaatcaatggcaatctc
ttaggtttgccgtgcgactacgattctgcaaatttaattgtttttgcagttccttgggaa
gttactgtttcctatggtgcaggtacagccaacggcccacaaagaattctggatgcttca
gtacaactagatttatttgactttgatcatcctgatggttggaaacaagggattttctta
gtggaaattccccaagaaatgatcgagaaaaataattattatcgggatttagcagcacaa
attattgaacggctagcccaaggtaaattactgacagatacaccagatttaacccctgta
ctgacagaaattaatcaagcttcccaacaggtaaatcaatggctgtttacacaatgtcaa
gcagctatgagtcaaggtaagcaagttgcagtcattggcggtgaccacagttcaccttta
ggttactttcaagcattagcagcgaaatactccaattttggcattctccacatcgatgca
cacgcagatttacgtgatgcttatgaagggtttgaattttcccatgcgtcgattatgttt
aatgggttgaaattaccgcaaatttctaaactagtgcaggtaggtttacgcgatatcagt
catgatgaagtgcgaatgattgaggaatcccatggacgcatcgtggcatactacgacccc
atgattaaacaaaagctctatggtgagacaaattggatcgaactaagccgcgaaattgtg
aatcatttaccggaatacgtccacattagttttgatgtggatggtttagatccaaaactt
tgtccaaataccggtacacccgttcctggtggtttggaattggagcaagttttttgtcta
tttcgggaattagtgaatagcgggagaaaaattatcggcttcgatgtctgcgaagttggt
gatgctgaatgggatggtaatgtaggggcgagagtggtttataaattagcaaatttaatg
gatttatctcacaaacaataa

DBGET integrated database retrieval system