KEGG   Nostoc sp. PCC 7120: alr2816Help
Entry
alr2816           CDS       T00069                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    alr2816
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    alr2816
Enzymes [BR:ana01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     alr2816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3424720..3427134
Genome map
AA seq 804 aa AA seqDB search
MTNQFSPQIPSSTWNRPIGLGWDKPYTVRYASNIDDGPWHGMPLGGFGAGCIGRSSRGDF
NLWHIDGGEHIFQNFPACQFSVFEANGTSSQAYALSTQPTDDESLKSWQWYPASSETQTT
GTYHALYPRSWFVYENVFQAELTCEQFSPIWANNYQETSYPVAVFAWQAHNPTNAPITLS
IMLTWQNMVGWFTNALKSPDVRVRDDGSPVYEYQPRLGESGGNYNYLDESPQHLGCFLGR
VGMTEPLQEGEGSWCIATLKHSQVEVFYHTRWNPVGTGEEVWQSFAADGSLANHIDTSSV
TENEQLGAAIAVRFTLQPGETLEIPFVVSWDLPVTEFAAGVNYYRRYTDFFGKTGDHAWA
IATTALEQYKTWQQQIESWQDPILNRPDLPDWFKMALFNELYDLTSGGTLWSAATPCDPI
GQFAVLECLDYRWYESLDVRLYGSFGLLQLFPELEKAVMRAFARAIPQGDDTPRVIGYYY
TIGAESPIAVRKTPGATPHDLGAPNEHVWEKTNYTSYQDCNLWKDLGCDFVLQVYRDFLL
TGADDVQFLRDCWDAIVETLDYVKTFDLDGDGIPENSGAPDQTFDDWRLQGVSAYCGGLW
LAALAAAIAISDILLQNHQDSATKEHLLYQKSTYETWLTKSLPIYQEKLWNGKYYRLDSE
SGSDVVMADQLCGQFYANLLELPDIVPSDRAISALQTVYDACFLKFYDGQFGAANGVRPD
GSPENPKATHPLEVWTGINFGLAAFLVQMGMKDEGFRLTQAVVEQIYNNGLQFRTPEAIT
AAGTFRASTYLRPMAIWAIYLMIG
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaattctccccgcaaattccctcctctacttggaatcgtcctattggctta
ggttgggataaaccttatactgtccgctatgcgagtaatattgatgatgggccttggcat
ggtatgccattgggcggctttggtgctggttgtattggtcgttcttcgcggggagacttt
aacctatggcacattgacggtggtgagcatattttccaaaattttcccgcctgtcaattt
agtgtatttgaagcaaatggcacttcttcccaagcttatgctttgtctacacaaccaaca
gacgatgaaagcttgaaaagttggcaatggtatccagcatctagcgaaacacagacaaca
gggacatatcacgccttgtatccccgtagttggtttgtgtatgagaatgtgtttcaggca
gagttaacttgtgagcagttttcccctatctgggcaaataattatcaagagactagttac
cctgtagcggtatttgcttggcaagcgcataaccccacgaatgcgcccataacactcagt
atcatgctgacctggcaaaatatggtgggttggtttactaatgccctcaaatctcctgat
gtgcgggtgcgggatgatggtagcccggtttatgagtatcagccgcgcttaggggaaagt
gggggaaattataactatttagatgaaagtccccaacatctgggttgctttttggggcgg
gtggggatgactgaacctttacaggaaggtgaggggagttggtgcattgcaactctgaaa
cattcccaagttgaagttttttaccatacacgatggaatcctgtcggtacgggtgaggag
gtatggcagagttttgcggcggatggttccttagctaatcatatagatacctcgtcagtc
acagaaaatgaacagttaggagctgctattgctgtacgtttcaccctgcaaccaggggaa
accttagaaatcccctttgtggtgagttgggatttacctgtgacagaatttgctgctgga
gtgaattactatcgcagatatacagacttttttggtaaaactggtgatcatgcttgggcg
atcgcaactactgctctagaacagtataaaacttggcaacaacaaatcgaaagttggcaa
gaccccatactgaatcgtcccgatttgcccgactggttcaaaatggcattgtttaatgag
ctttatgacctcactagcggggggactctctggagtgcggcgacaccatgcgatcccatc
ggtcaatttgcggtgctggaatgcctagattaccgatggtatgaaagcttagatgtgcgc
ctgtatggttcctttgggttgttgcaactgttcccagaactggaaaaagcagttatgcgg
gcttttgcgcgggcaattccccaaggggatgataccccccgtgtgattggttattactac
accattggggcagaaagtcccattgctgtgcgtaaaactccaggcgcaacaccccacgat
ttaggcgcacccaatgaacacgtctgggaaaaaactaattacaccagctatcaagattgc
aatttgtggaaggatttaggctgtgattttgtcttgcaagtgtatcgggattttctccta
actggtgcggatgatgtgcagttcttaagggattgctgggatgcaattgtggaaaccctt
gattatgtaaaaacattcgatttagatggcgatgggattccggaaaattccggtgcgcca
gaccaaacctttgatgattggcgtttgcaaggagttagcgcctattgtggtggcttgtgg
ttggctgcattggcagcagcgatcgctatcagtgacatcttattacaaaatcaccaagat
tcagcaaccaaagaacatctactttaccaaaaatccacctatgaaacttggttaacaaaa
tccctacctatctatcaagaaaaactctggaatggtaaatattatcggctagatagtgaa
agtggttctgatgttgttatggcagatcaattgtgtggacaattctacgccaacttactg
gaattaccggacattgtaccaagcgatcgcgcaatttctgcactccaaactgtttatgat
gcttgcttcctcaagttttatgacggtcaatttggtgcagccaatggagtacgtcccgat
ggttcaccagagaacccgaaagctacccaccccttagaagtgtggacaggaattaacttt
gggttggcagcatttttagtacaaatgggaatgaaagacgaaggtttcaggttgacacaa
gcagtagtagagcaaatctataataatggcttacaattccgcacacccgaagccatcacc
gccgccggtactttccgcgccagtacctatctccgccctatggcgatttgggcaatatat
ttgatgattggttag

DBGET integrated database retrieval system