KEGG   Nostoc sp. PCC 7120: alr2973Help
Entry
alr2973           CDS       T00069                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00010  Glycolysis / Gluconeogenesis
ana00052  Galactose metabolism
ana00500  Starch and sucrose metabolism
ana00520  Amino sugar and nucleotide sugar metabolism
ana00521  Streptomycin biosynthesis
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01120  Microbial metabolism in diverse environments
ana01130  Biosynthesis of antibiotics
ana01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    alr2973
   00052 Galactose metabolism
    alr2973
   00500 Starch and sucrose metabolism
    alr2973
   00520 Amino sugar and nucleotide sugar metabolism
    alr2973
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    alr2973
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    alr2973
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     alr2973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: BAB74672
CyanoBase: alr2973
CYORF: alr2973
UniProt: P58616
Position
3616207..3617235
Genome map
AA seq 342 aa AA seqDB search
MTLLLAGDIGGTKTILRLVEISNSSELHNIYEESYQSGDFPDLVPMVQQFLVKANIPSHP
EKACFAIAGPVVNNTAKLTNLVWFLDTERLAQELSIPFISLINDFAAVGYGIFGLNKQDL
LTLQAGKHQPEAPIAIIGAGTGLGQGFLIKQGNQYQVFPSEGGHADFAPRNELEFQLLKY
LLDKHDIQRVSVERVVSGQGIVAIYQFLRDRKLATESPEIAQVVRTWEQQAGQAEKTVDP
GAAIGKAAVQGSDRLSEQALQLFIDAYGAEAGNLALKLLPYGGLYIAGGIAPKILPLIEN
SNFLLNFSQKGRMRPLLAEIPVHIILNQQVGLIGAALCAARL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccttattgttagcaggagatatcggcgggacgaaaacgattttgcgattggtagaa
atatcaaattcgtcggaactgcacaatatttatgaggaaagttaccagagtggggatttt
ccagatttagtgccgatggtgcagcaattcttagtcaaggctaatatacctagtcacccc
gaaaaggcttgctttgcgatcgctggccctgtggtgaataatactgccaaactgaccaat
ttagtctggtttttggacactgaacggctagcacaagaattaagtattcccttcatttcc
ttaattaatgattttgctgctgttggctatgggatttttgggttaaataaacaagacttg
ctgaccttacaagctggtaaacatcaaccagaagcacctattgctattattggtgctggc
actggattaggacaaggatttttaattaaacagggaaaccagtatcaagttttcccctcg
gaaggtggacacgccgactttgccccccgcaacgagttagagtttcagttgttgaaatat
ctgctggataaacatgatatccagcgcgtttctgtggaaagggtggtttctggacagggg
attgtcgccatttatcaatttttacgcgatcgcaaactcgctacagaatcgccagaaatt
gctcaagttgtccgcacttgggaacaacaagcaggacaggctgaaaaaaccgttgatcct
ggtgcggctattggtaaagccgcagtccaaggaagcgatcgcctttcggaacaagcccta
caattatttatcgatgcttacggtgcagaagcgggaaatcttgccctcaaactcctacca
tacggcggcttgtacattgcgggtgggattgcgcctaaaatcctacctttgattgaaaat
agcaattttttgcttaatttcagccaaaaaggcagaatgcgtcctctgctagcagaaata
ccggtgcatattattctcaatcaacaagtgggactcataggtgctgctttgtgtgctgct
aggttataa

DBGET integrated database retrieval system