KEGG   Nostoc sp. PCC 7120: alr2973Help
Entry
alr2973           CDS       T00069                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    alr2973 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    alr2973 (glk)
   00052 Galactose metabolism
    alr2973 (glk)
   00500 Starch and sucrose metabolism
    alr2973 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    alr2973 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    alr2973 (glk)
   00524 Butirosin and neomycin biosynthesis
    alr2973 (glk)
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     alr2973 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3616207..3617235
Genome map
AA seq 342 aa AA seqDB search
MTLLLAGDIGGTKTILRLVEISNSSELHNIYEESYQSGDFPDLVPMVQQFLVKANIPSHP
EKACFAIAGPVVNNTAKLTNLVWFLDTERLAQELSIPFISLINDFAAVGYGIFGLNKQDL
LTLQAGKHQPEAPIAIIGAGTGLGQGFLIKQGNQYQVFPSEGGHADFAPRNELEFQLLKY
LLDKHDIQRVSVERVVSGQGIVAIYQFLRDRKLATESPEIAQVVRTWEQQAGQAEKTVDP
GAAIGKAAVQGSDRLSEQALQLFIDAYGAEAGNLALKLLPYGGLYIAGGIAPKILPLIEN
SNFLLNFSQKGRMRPLLAEIPVHIILNQQVGLIGAALCAARL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccttattgttagcaggagatatcggcgggacgaaaacgattttgcgattggtagaa
atatcaaattcgtcggaactgcacaatatttatgaggaaagttaccagagtggggatttt
ccagatttagtgccgatggtgcagcaattcttagtcaaggctaatatacctagtcacccc
gaaaaggcttgctttgcgatcgctggccctgtggtgaataatactgccaaactgaccaat
ttagtctggtttttggacactgaacggctagcacaagaattaagtattcccttcatttcc
ttaattaatgattttgctgctgttggctatgggatttttgggttaaataaacaagacttg
ctgaccttacaagctggtaaacatcaaccagaagcacctattgctattattggtgctggc
actggattaggacaaggatttttaattaaacagggaaaccagtatcaagttttcccctcg
gaaggtggacacgccgactttgccccccgcaacgagttagagtttcagttgttgaaatat
ctgctggataaacatgatatccagcgcgtttctgtggaaagggtggtttctggacagggg
attgtcgccatttatcaatttttacgcgatcgcaaactcgctacagaatcgccagaaatt
gctcaagttgtccgcacttgggaacaacaagcaggacaggctgaaaaaaccgttgatcct
ggtgcggctattggtaaagccgcagtccaaggaagcgatcgcctttcggaacaagcccta
caattatttatcgatgcttacggtgcagaagcgggaaatcttgccctcaaactcctacca
tacggcggcttgtacattgcgggtgggattgcgcctaaaatcctacctttgattgaaaat
agcaattttttgcttaatttcagccaaaaaggcagaatgcgtcctctgctagcagaaata
ccggtgcatattattctcaatcaacaagtgggactcataggtgctgctttgtgtgctgct
aggttataa

DBGET integrated database retrieval system