KEGG   Nostoc sp. PCC 7120: alr3103Help
Entry
alr3103           CDS       T00069                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    alr3103
  Amino acid metabolism
   00330 Arginine and proline metabolism
    alr3103
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    alr3103
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     alr3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3754949..3755929
Genome map
AA seq 326 aa AA seqDB search
MILVSSGAVGVGCARLGLTERPKAIALKQAVAAVGQGRLMRVYDDLFTTLQQPIAQVLLT
RSDLVQRSRYLNVYNTFRELLALGVIPVVNENDTVAVDELKFGDNDTLSALVASLVEADW
LFLLTDVDRLYSADPRSVPDARPISLVTSIKELADLQVQTGSQGSQWGTGGMMTKISAAR
IAIAAGVRTVITQGRYPRNIEKIIQGELIGTHFQPQPEPTSARKRWIAYGLVPVGKLYLD
SGAIAAIVKAGKSLLPAGVKTVAGEFEPQDAVQLCDPQGNEIARGLVNYSSNDLQKICGR
HSKEIPTILGYVGAETVIHRDNLVLT
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgattttagtttcctctggggctgtgggagtgggttgtgcgcggttgggtttaaccgaa
cgtcccaaagcgatcgccctcaaacaggcggtggccgcagtgggtcaaggtcgattaatg
cgcgtatatgacgacttatttaccaccttacaacagccaattgcccaagtgttgctaact
cgcagcgatttggtacaacgtagccgttatctcaacgtatacaacacctttcgggaatta
ctcgcgttgggggtaattcctgtagtcaacgagaatgataccgttgccgtcgatgaactg
aaatttggtgataatgataccctttcggctttggttgctagtcttgtagaggcggactgg
ctatttttactcacagacgtagaccgattatactcagccgatccccgttctgtccccgat
gcccgaccaatatctttggtgacaagcatcaaagaattagcagacttacaagtgcaaaca
ggttctcaaggttctcaatggggtactgggggaatgatgacaaaaatttcggcggcgaga
attgcgatcgcggcgggagtgcgtactgtgattactcaaggacgatacccccgtaatatc
gagaaaattatccaaggggaactgattggaactcattttcaaccccaaccagaaccaact
tccgcccgtaaacgttggattgcttacggtttagtcccggttggtaaattatacttagat
tctggtgcgatcgccgctatagttaaagcaggtaaatccttattgccagcaggagttaaa
accgttgcaggtgaatttgagcctcaagatgcagtacagttatgcgatcctcaaggtaac
gaaattgccagaggactggttaactatagcagcaatgatttacagaaaatttgtggtcgt
cattctaaggagattccgacgattttgggttatgtaggtgcggaaaccgtgatccatcga
gataacttagtattgacttaa

DBGET integrated database retrieval system