KEGG   Nostoc sp. PCC 7120: alr3230Help
Entry
alr3230           CDS       T00069                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    alr3230
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     alr3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3900913..3901866
Genome map
AA seq 317 aa AA seqDB search
MRSYKLIAPAKINLYLEIIGDRPDGYHELVMILQSIDLADEIEIHSLSSETIHVHCNHPQ
VPTDKSNLVYRAAELMVTRFPEAFTKHGGVDITVHKHIPVAAGLAGGSTNAAAVLVGIDL
LWNLGLTQTELEELGSTLGSDVPFCVAGGTVIATGRGEQLSPLPSLDHIYIVLGKYRSLE
VSTAWAYKNYRQEYGSTYLRDTNDLASRAAAVHSGSIVKAIVEKDAVAIAQRLHNDLEKV
VLPSYPQVLHLRELLASQPGVIGTMMSGSGPSVFALCETQAQAEQVQQQVRQTIPDEDLE
LFVTRTITHGIQVVGNG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcctacaaattaattgctcccgccaaaattaacttgtatctagaaatcatcggc
gacagacccgatgggtatcatgagttagtgatgatattgcaaagtatcgacctagccgac
gagattgaaatacattccctcagcagtgaaactatccacgttcattgcaaccacccacaa
gttcccacagacaaaagtaatctcgtatatcgcgccgccgaactgatggtgacaagattt
cctgaagccttcacgaaacatgggggtgtagatattaccgttcacaaacatattcccgta
gcagctggcttggctggaggttcaactaacgccgcagctgtgttagtcgggatagattta
ctttggaacttgggactaacccaaacagaactagaagagttaggctctactcttggttcc
gacgtaccattttgtgtggctggtggtacagtcatcgccacaggtagaggagaacaactt
tcccccttgcccagtttggatcatatatatatagtattaggcaaatatcgcagcttagaa
gtttccaccgcctgggcatataaaaactaccgtcaagaatatggtagtacttatcttaga
gataccaatgacttagcctcccgcgccgccgcagttcattcaggtagtatagttaaggct
attgtagaaaaagatgctgtagcgatcgcccaaagactgcacaatgatttagagaaagta
gtattaccttcctatccgcaagttttgcacctccgagaattgttagcatctcaaccaggt
gttatcggaaccatgatgtctggttcaggcccttcagtatttgctctgtgtgaaactcaa
gcacaagcagaacaagttcagcagcaagtaagacaaacaattcccgacgaagatttagaa
ttatttgtaactcgcacaattacacatgggattcaagttgtgggtaatgggtaa

DBGET integrated database retrieval system