KEGG   Nostoc sp. PCC 7120: alr3450Help
Entry
alr3450           CDS       T00069                                 

Definition
uroporphyrinogen III methylase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    alr3450
Enzymes [BR:ana01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     alr3450
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     alr3450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4158588..4160141
Genome map
AA seq 517 aa AA seqDB search
MTQQNGKVYLVGAGPGDVAYLTVKAYNLLATAQVLVYDALVDEQLLQCVSSDCLKLDVGK
RGGKPSTPQTEINNLLVKFCQEGALVVRLKSGDPFIFGRSTSEIEALKAAGCEFEVVPGI
SSAIAAPLLAGIPLTDPVMSRCFAVLTAHEPEVLDWEALSRLDTLVILMGGKNLADIVHE
LLRRERSHLTPIAIIRWAGTPSQEIWTGQLGDILQQTAGLSLSPVVIVIGEVVRLRKYLQ
PEKIFPENSTTPMSSNQPLTGKTILVTRSSGQSSQFSDRLTTLGATVIEMPALEIGPPSS
WKELDQAIANLSHFDWLILTSTNGVDYFFERLYIQGKDTRALAGLKIAVVGEKTSQSLKQ
RGIQADFIPPNFVADSLVEHFPESLLNKKILFPRVESGGREILVKELSAKGADVIEVAAY
QSCCPTSIPLAAELALKNRTIHIITFASSKTVQFFCQLADKIFPHNIPNALEGICIASIG
PQTSKTCHTLLGRVDIEAEEYTLDGLTQAIIQWSLKP
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaaaatggcaaagtttaccttgtaggtgcggggccgggagatgtggcatac
ctcacagtgaaagcttataatctactggctacggctcaagtgttggtttatgatgcccta
gtggatgagcaattgttgcagtgtgtatcatctgattgtctgaaactagatgtagggaag
cgtggcggtaaacccagcacaccgcaaacggaaatcaataatttattagttaagttctgc
caagaaggtgcattagtcgttaggttgaaatcaggtgacccgtttatttttggtcggagt
acctcagaaattgaggctttgaaagcagcaggctgtgaatttgaagtagtaccaggaatt
tcctcagctatagcagcacctttattagcaggaatcccgcttacagacccggtgatgagt
cgttgctttgcagtgctgacagcccatgaaccagaagttttagactgggaggcgctatca
aggttagacaccctagtcatattaatgggtgggaaaaacctcgcagatattgtacatgaa
cttctacggagagagcgatcgcatctcacacctatagctattattcgctgggcaggaacc
cccagtcaagaaatttggactggtcaactgggggatattctccaacaaacagcaggttta
tctctctccccagtcgttatcgtcattggtgaagtcgtcaggctacgcaagtacctacaa
cctgagaaaatatttccagagaactcaactacacctatgtccagcaaccaacctctcact
ggaaaaaccatcctcgtcacccgttcatctggtcaatcgagtcaatttagcgatcgccta
actacacttggcgctacagtaattgaaatgccagcgttagaaataggccccccttctagt
tggaaagagttagatcaggcgatcgctaatttatctcactttgactggttaattctcact
tccaccaacggcgtagattatttctttgaaaggctatatatccaaggtaaagatactcgt
gctttagctgggttaaaaatcgctgtcgttggggaaaaaacctcccaaagcctcaaacaa
agaggaatccaagcagattttattccccctaactttgtggctgattctttagtagagcat
tttcccgaatcactactaaataaaaagattttattccccagagtggaaagcggcggtagg
gaaattttagtcaaagaattatccgcaaaaggtgcagatgtcattgaagtagctgcttat
caatcttgttgtcccactagtattcccctagcagcagaactagccttaaaaaatcgcaca
atacatatcattacctttgccagttctaaaaccgtgcagtttttctgtcaacttgcagac
aaaatatttcctcacaatattcccaatgctttagaaggaatatgtattgcttccatcgga
ccccaaacttcaaaaacttgtcataccctattaggtagagtcgatatagaagctgaagaa
tacaccttagatggattaacccaagcaatcatccaatggtcattaaaaccctaa

DBGET integrated database retrieval system