KEGG   Nostoc sp. PCC 7120: alr3522Help
Entry
alr3522           CDS       T00069                                 

Gene name
leuA
Definition
(GenBank) 2-isopropylmalate synthase
  KO
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    alr3522 (leuA)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    alr3522 (leuA)
Enzymes [BR:ana01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     alr3522 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4243164..4244798
Genome map
AA seq 544 aa AA seqDB search
MTKNPSPHIWLYDTTLRDGTQREGLSISTEDKLRIAHRLDQLGIPFIEGGWPGANPKDVQ
FFWQLHEDPLKHSQIVAFCSTRRPHTHAADEPMLQDILAAGSSWVTIFGKSWDLHVTTGL
KTTLEENLAMIRDTIEFFRSQGRCVIYDAEHWFDGYKHNRDYALQTLKAAMTAGAEWLVL
CDTNGGTLPHEVSQIVQDVVEVTREDLTQLPIPQIGIHTHNDSDMAVANALAAVMAGATM
VQGTINGYGERCGNANLCSLIPNLQLKLGYSCITEHQLGQLAEASRFVSEVVNLAPDEHA
PFVGRSAFAHKGGIHVSAVERNPLTYEHIQPEQVGNRRRIVISEQAGISNVLAKARTFGI
ELDKQTPEAKQILQRLKELESEGYQFEAAEASFALLMYEALGGRQQFFEVKGFQVHCDLV
EGKEMTNALATVKVAVNGKNILEAAEGNGPVAALDAALRKALVNFYPQLATFELTDYKVR
ILDGHTGTSAKTRALVESGNGYQRWTTVGVSPNILAASYQAVVEGLEYGLLLHAQAEAAV
KASG
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaatccctcaccccacatttggctttatgacaccacactacgggatggcact
cagcgcgaagggctatcaatttctacagaagacaagctacgcattgcccacagactcgat
caactagggattcccttcattgaaggtggatggccaggagccaaccctaaggatgttcaa
tttttctggcaacttcacgaagatccgctcaaacattcacaaattgttgcattttgttca
actcgccgccctcatactcatgccgcagatgaaccaatgctccaagatatcctggctgcg
ggttctagctgggtgacaatttttggcaaatcctgggatttacacgtcacaacaggtcta
aaaactactttagaagaaaacttggcaatgatccgcgatactatcgagttttttcgctct
caagggcgatgcgtgatctatgatgctgaacactggtttgatggctataagcacaaccga
gattatgctttacagaccctcaaggcagcaatgacagccggtgcagaatggttagtcctc
tgtgatacgaatggcggtactttacctcacgaagttagccagattgttcaagatgttgtc
gaggtgactagggaagatttgacccaattaccaataccccaaatcggtattcatactcat
aatgattcagatatggctgttgccaatgctttagcagcagtaatggcaggggcgacaatg
gtacaaggtactatcaacggttatggcgaacgttgtgggaatgctaatttatgttcatta
attcctaatctacaactgaaattagggtatagctgtatcacagaacaccagctaggacaa
ctagcagaagccagccgatttgtgagtgaagtggtaaatcttgcccctgatgaacacgct
ccttttgtgggacgttcggcttttgctcacaaaggtggtattcatgtctccgccgtggaa
cgtaatcccctaacttatgaacacattcagccggaacaagtggggaaccgccgccggatt
gtcatttctgaacaagcggggattagtaatgtgttagctaaagcccggacttttggcatt
gaactcgacaagcaaacaccagaagccaagcaaattcttcagcgcctcaaggaattagaa
agtgaaggatatcaatttgaagcagccgaagcgagttttgctttattgatgtatgaagct
ttgggcggaagacagcagttttttgaagttaaaggctttcaagtccactgtgatttagtg
gaaggcaaagaaatgaccaatgctttagcgacggtgaaagtcgcggtgaatggtaagaac
attttagaagctgccgaaggtaatgggccagtagcagccttagatgcagcgttacgcaaa
gctttagtcaacttctatccccaacttgccacctttgagttaacagattacaaagtgcgg
attctcgacggtcacacaggcacttctgccaaaacccgtgccttagtcgaatcaggcaat
ggttatcaacgctggacaacggttggcgtttcaccgaacattttggcagcttcctatcaa
gcggttgtcgaaggtttggaatatggtctgttattacacgcccaagcagaagccgcagta
aaagcgtctggttaa

DBGET integrated database retrieval system