KEGG   Anabaena sp. PCC7120: alr3522Help
Entry
alr3522           CDS       T00069                                 

Gene name
leuA
Definition
alpha-isopropylmalate synthase
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
ana  Anabaena sp. PCC7120
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:ana01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ana01230]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ana00620]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:ana00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4243164..4244798
Genome map
AA seq 544 aa AA seqDB search
MTKNPSPHIWLYDTTLRDGTQREGLSISTEDKLRIAHRLDQLGIPFIEGGWPGANPKDVQ
FFWQLHEDPLKHSQIVAFCSTRRPHTHAADEPMLQDILAAGSSWVTIFGKSWDLHVTTGL
KTTLEENLAMIRDTIEFFRSQGRCVIYDAEHWFDGYKHNRDYALQTLKAAMTAGAEWLVL
CDTNGGTLPHEVSQIVQDVVEVTREDLTQLPIPQIGIHTHNDSDMAVANALAAVMAGATM
VQGTINGYGERCGNANLCSLIPNLQLKLGYSCITEHQLGQLAEASRFVSEVVNLAPDEHA
PFVGRSAFAHKGGIHVSAVERNPLTYEHIQPEQVGNRRRIVISEQAGISNVLAKARTFGI
ELDKQTPEAKQILQRLKELESEGYQFEAAEASFALLMYEALGGRQQFFEVKGFQVHCDLV
EGKEMTNALATVKVAVNGKNILEAAEGNGPVAALDAALRKALVNFYPQLATFELTDYKVR
ILDGHTGTSAKTRALVESGNGYQRWTTVGVSPNILAASYQAVVEGLEYGLLLHAQAEAAV
KASG
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaatccctcaccccacatttggctttatgacaccacactacgggatggcact
cagcgcgaagggctatcaatttctacagaagacaagctacgcattgcccacagactcgat
caactagggattcccttcattgaaggtggatggccaggagccaaccctaaggatgttcaa
tttttctggcaacttcacgaagatccgctcaaacattcacaaattgttgcattttgttca
actcgccgccctcatactcatgccgcagatgaaccaatgctccaagatatcctggctgcg
ggttctagctgggtgacaatttttggcaaatcctgggatttacacgtcacaacaggtcta
aaaactactttagaagaaaacttggcaatgatccgcgatactatcgagttttttcgctct
caagggcgatgcgtgatctatgatgctgaacactggtttgatggctataagcacaaccga
gattatgctttacagaccctcaaggcagcaatgacagccggtgcagaatggttagtcctc
tgtgatacgaatggcggtactttacctcacgaagttagccagattgttcaagatgttgtc
gaggtgactagggaagatttgacccaattaccaataccccaaatcggtattcatactcat
aatgattcagatatggctgttgccaatgctttagcagcagtaatggcaggggcgacaatg
gtacaaggtactatcaacggttatggcgaacgttgtgggaatgctaatttatgttcatta
attcctaatctacaactgaaattagggtatagctgtatcacagaacaccagctaggacaa
ctagcagaagccagccgatttgtgagtgaagtggtaaatcttgcccctgatgaacacgct
ccttttgtgggacgttcggcttttgctcacaaaggtggtattcatgtctccgccgtggaa
cgtaatcccctaacttatgaacacattcagccggaacaagtggggaaccgccgccggatt
gtcatttctgaacaagcggggattagtaatgtgttagctaaagcccggacttttggcatt
gaactcgacaagcaaacaccagaagccaagcaaattcttcagcgcctcaaggaattagaa
agtgaaggatatcaatttgaagcagccgaagcgagttttgctttattgatgtatgaagct
ttgggcggaagacagcagttttttgaagttaaaggctttcaagtccactgtgatttagtg
gaaggcaaagaaatgaccaatgctttagcgacggtgaaagtcgcggtgaatggtaagaac
attttagaagctgccgaaggtaatgggccagtagcagccttagatgcagcgttacgcaaa
gctttagtcaacttctatccccaacttgccacctttgagttaacagattacaaagtgcgg
attctcgacggtcacacaggcacttctgccaaaacccgtgccttagtcgaatcaggcaat
ggttatcaacgctggacaacggttggcgtttcaccgaacattttggcagcttcctatcaa
gcggttgtcgaaggtttggaatatggtctgttattacacgcccaagcagaagccgcagta
aaagcgtctggttaa

DBGET integrated database retrieval system