KEGG   Nostoc sp. PCC 7120: alr3522Help
Entry
alr3522           CDS       T00069                                 

Gene name
leuA
Definition
alpha-isopropylmalate synthase
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    alr3522 (leuA)
   01230 Biosynthesis of amino acids
    alr3522 (leuA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    alr3522 (leuA)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    alr3522 (leuA)
Enzymes [BR:ana01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     alr3522 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4243164..4244798
Genome map
AA seq 544 aa AA seqDB search
MTKNPSPHIWLYDTTLRDGTQREGLSISTEDKLRIAHRLDQLGIPFIEGGWPGANPKDVQ
FFWQLHEDPLKHSQIVAFCSTRRPHTHAADEPMLQDILAAGSSWVTIFGKSWDLHVTTGL
KTTLEENLAMIRDTIEFFRSQGRCVIYDAEHWFDGYKHNRDYALQTLKAAMTAGAEWLVL
CDTNGGTLPHEVSQIVQDVVEVTREDLTQLPIPQIGIHTHNDSDMAVANALAAVMAGATM
VQGTINGYGERCGNANLCSLIPNLQLKLGYSCITEHQLGQLAEASRFVSEVVNLAPDEHA
PFVGRSAFAHKGGIHVSAVERNPLTYEHIQPEQVGNRRRIVISEQAGISNVLAKARTFGI
ELDKQTPEAKQILQRLKELESEGYQFEAAEASFALLMYEALGGRQQFFEVKGFQVHCDLV
EGKEMTNALATVKVAVNGKNILEAAEGNGPVAALDAALRKALVNFYPQLATFELTDYKVR
ILDGHTGTSAKTRALVESGNGYQRWTTVGVSPNILAASYQAVVEGLEYGLLLHAQAEAAV
KASG
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaatccctcaccccacatttggctttatgacaccacactacgggatggcact
cagcgcgaagggctatcaatttctacagaagacaagctacgcattgcccacagactcgat
caactagggattcccttcattgaaggtggatggccaggagccaaccctaaggatgttcaa
tttttctggcaacttcacgaagatccgctcaaacattcacaaattgttgcattttgttca
actcgccgccctcatactcatgccgcagatgaaccaatgctccaagatatcctggctgcg
ggttctagctgggtgacaatttttggcaaatcctgggatttacacgtcacaacaggtcta
aaaactactttagaagaaaacttggcaatgatccgcgatactatcgagttttttcgctct
caagggcgatgcgtgatctatgatgctgaacactggtttgatggctataagcacaaccga
gattatgctttacagaccctcaaggcagcaatgacagccggtgcagaatggttagtcctc
tgtgatacgaatggcggtactttacctcacgaagttagccagattgttcaagatgttgtc
gaggtgactagggaagatttgacccaattaccaataccccaaatcggtattcatactcat
aatgattcagatatggctgttgccaatgctttagcagcagtaatggcaggggcgacaatg
gtacaaggtactatcaacggttatggcgaacgttgtgggaatgctaatttatgttcatta
attcctaatctacaactgaaattagggtatagctgtatcacagaacaccagctaggacaa
ctagcagaagccagccgatttgtgagtgaagtggtaaatcttgcccctgatgaacacgct
ccttttgtgggacgttcggcttttgctcacaaaggtggtattcatgtctccgccgtggaa
cgtaatcccctaacttatgaacacattcagccggaacaagtggggaaccgccgccggatt
gtcatttctgaacaagcggggattagtaatgtgttagctaaagcccggacttttggcatt
gaactcgacaagcaaacaccagaagccaagcaaattcttcagcgcctcaaggaattagaa
agtgaaggatatcaatttgaagcagccgaagcgagttttgctttattgatgtatgaagct
ttgggcggaagacagcagttttttgaagttaaaggctttcaagtccactgtgatttagtg
gaaggcaaagaaatgaccaatgctttagcgacggtgaaagtcgcggtgaatggtaagaac
attttagaagctgccgaaggtaatgggccagtagcagccttagatgcagcgttacgcaaa
gctttagtcaacttctatccccaacttgccacctttgagttaacagattacaaagtgcgg
attctcgacggtcacacaggcacttctgccaaaacccgtgccttagtcgaatcaggcaat
ggttatcaacgctggacaacggttggcgtttcaccgaacattttggcagcttcctatcaa
gcggttgtcgaaggtttggaatatggtctgttattacacgcccaagcagaagccgcagta
aaagcgtctggttaa

DBGET integrated database retrieval system