KEGG   Nostoc sp. PCC 7120: alr3710Help
Entry
alr3710           CDS       T00069                                 

Gene name
devB
Definition
(GenBank) heterocyst specific ABC-transporter, membrane fusion protein
  KO
K02005  
HlyD family secretion protein
Organism
ana  Nostoc sp. PCC 7120
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4478870..4480294
Genome map
AA seq 474 aa AA seqDB search
MSRVTEERRSREQPLDLEQPKIWWGLAVALPVAVAAGLLATAKFEQLKRLGPSVPVKPVI
TSVSAVGRLEPQGEVIKLSAPVGGMQSASRVKQLFVKEGERVRKGQVIAILDNHDTQLAA
VEEAKAKLLESRANLAQVRVGSPRDIQAQTAVIARLQAQLVGEMGAQQASITRIASQLSG
EKVAQQALVNRLEAELVGQQDSLRATLNRIRAEQRNAQVDAGRYDFLYREGAISQQERDR
RRLTATTANQQVIESQAALRQALATLRQQVAEARANQMKTLASLQQQLIEARVTRDKTIT
TLQRQIDEEKARLKRLVEVSPTDVQMAQAQVSNAIANVRRAEAELKLSYIQAPSAGEILK
IYSKSGEAITADGIAEMGETEQMMIIAEVPEDSIGRVRIGQTVTANSDNGAFSGEIRGTV
TEIGRKIGKKDVLNTDPAADVDARVVEVKIALSPEDSQKVSGLTYAKVVVDINK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagggtgacggaagagcgtaggtcaagagagcagccacttgatctagaacaacct
aagatttggtggggtcttgctgtagccctaccagtagccgtggctgcggggttactagct
acagctaaatttgagcaattaaaaaggctaggcccatccgtacctgttaagccagtcatt
actagtgttagtgctgtgggacgtttagaaccgcaaggggaagtgattaaactttcggct
cccgtcggaggaatgcaatcagcctcacgagttaaacaactctttgtgaaagagggagaa
cgggttaggaagggtcaagttatagcaattttggataaccacgatacccaactagcagca
gtggaagaagcgaaagccaaattactggaatctcgcgctaacttggctcaagtccgggtt
ggttctcccagggatatccaagcgcaaacagctgtgattgcccgcttacaggcgcagtta
gttggtgaaatgggggcgcaacaagcaagcattacgcgtattgcatcccaattaagtggg
gaaaaggtggcgcaacaagcactagttaatcgtttagaagcagaacttgtaggccaacaa
gactctttaagagccacattgaaccgcattagagccgagcagcgtaatgctcaagtagat
gcgggacgctatgattttctctacagagaaggtgctatttcccagcaggagcgagacaga
aggcgactgactgcgactactgctaatcaacaggtaattgaaagtcaagccgctttgaga
caggctctagccactctcagacagcaagttgctgaagctagagctaatcagatgaaaact
ctagccagtttgcaacagcaactaatcgaagcgagagtaacccgcgataaaaccataact
acattacaaagacaaattgacgaagaaaaagccagactgaaaagattggtggaagttagt
cctactgatgtgcagatggctcaagctcaagttagtaatgcgatcgccaacgtcagaaga
gccgaggccgaattaaaattaagctacattcaagcaccctcggcgggagaaatcttaaaa
atttatagcaagtcaggagaagccatcaccgccgacggtatagccgaaatgggagaaacc
gagcaaatgatgattattgctgaagttcctgaagatagtattggtcgggtacgaataggc
caaactgtcacagccaacagcgataacggagcctttagcggtgaaatcagaggaacagtg
accgagattggcagaaaaattggcaaaaaggatgtcttaaatacagatccagcagctgat
gttgatgccagagttgttgaagtcaaaattgccttatcaccggaagatagtcaaaaagtt
tctggtttaacctacgccaaggtagtggttgacattaataaataa

DBGET integrated database retrieval system