KEGG   Anabaena sp. PCC7120: alr3871Help
Entry
alr3871           CDS       T00069                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ana  Anabaena sp. PCC7120
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ana00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4670926..4672434
Genome map
AA seq 502 aa AA seqDB search
MPFIRSSGVLLHPTSCPSRFGIGDLGLEAYKFIDFLEKSYQQYWQVLPLGPTGYGNSPYM
SYSALAGNHLLISPEKLLDEGLLSDEDFAHLPNFPNEKVDFDQVAPIKIQLLKKACENFK
TKASPLQQKGFAGFCETKSYWLDDYALFMALKDTKDSSSWHTWEPALAKREPDALEKVQR
QLTDEIFYYKFIQYEFFRQWSELKSYANMRGIEIIGDIPIYVAHDSADVWANPDIFCLDE
ETGEVALMAGVPPDYFSATGQLWGNPVYNWEELQKQDFKWWVQRFEAMLDYVDVIRIDHF
RGFEAFWTVPQGEETAMNGEWVTAPGEELFDAIKQKLGKLPVLAEDLGVITPEVEALRDK
YEFPGMKVLQFAFGSDPGNPFLPFNYSRNFVVYTGTHDNDTTVGWFNTANDYEKNNLLLY
LGCISPEGIHWDLIRLALSSVANQAIVPLQDILGLGNEARMNFPSIAEGNWAWRYDFAVL
TDELSDRLKILTKLYGRAPQGK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccttttattagatcaagcggtgttctactgcatcctacctcgtgtcctagtcgattt
ggcattggggatttaggtttggaagcttacaaatttattgatttcctggaaaagagctat
caacaatattggcaagtcttacccttaggcccgactggatatggtaattctccttatatg
tcttactcagctttggcaggaaatcatctgctgattagcccagaaaaattactagatgaa
ggtttgctatctgacgaagattttgcccatctcccaaattttcccaatgaaaaagtagat
tttgatcaggttgcaccaatcaaaattcaactcctcaaaaaagcttgtgagaattttaag
actaaagcatcacccttacaacagaaagggtttgcggggttttgtgaaactaaaagctat
tggctagatgactatgccttattcatggcgctgaaggatactaaagatagctccagttgg
cacacttgggaaccagcactagcaaagcgagaaccagacgcattggagaaggttcagcgt
caactgacggatgagattttttattacaagttcattcaatatgaatttttccgccagtgg
tcagagttgaagagttacgccaatatgcgggggatcgaaattatcggtgatatcccgatt
tatgtagcccatgatagtgctgatgtctgggcgaatcctgatatattttgccttgatgaa
gaaacgggggaagttgcacttatggcgggtgtcccaccagattattttagtgctactggt
caattgtggggcaacccggtttacaactgggaggagttgcaaaaacaagactttaagtgg
tgggtacaacgttttgaggcgatgctcgattacgttgatgtgattcgtatcgaccacttc
cgaggctttgaagctttctggactgtaccccaaggtgaggaaacagctatgaatggtgag
tgggtaacagcaccaggggaagaactttttgatgcgattaagcaaaaactaggtaaatta
cctgttttggcggaagatttgggagtaattacaccagaagtagaagcgctacgagacaag
tacgaattcccagggatgaaggttttgcagtttgcttttggttctgaccctggaaatcct
tttttacctttcaactacagccgtaattttgtagtttatacagggactcacgataatgac
acaactgtaggttggtttaacacagccaatgattatgagaaaaacaatctgttactttat
ttaggttgtattagtcctgagggtatccactgggatttaattcgcttggctttgagttct
gtagcgaatcaagccattgttcctttacaagatattttaggcttgggtaatgaggcgcga
atgaattttcctagtattgctgagggaaattgggcgtggcgctatgattttgccgtgtta
acagatgaattaagcgatcgcttaaaaatcctcactaaactctatggtcgcgcacctcaa
ggtaaatag

DBGET integrated database retrieval system