KEGG   Nostoc sp. PCC 7120: alr4351Help
Entry
alr4351           CDS       T00069                                 

Definition
(GenBank) deoxyxylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00900  Terpenoid backbone biosynthesis
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01130  Biosynthesis of antibiotics
Module
ana_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    alr4351
Enzymes [BR:ana01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     alr4351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: BAB76050
CyanoBase: alr4351
CYORF: alr4351
UniProt: Q8YP49
Position
5214905..5216104
Genome map
AA seq 399 aa AA seqDB search
MVKSITLVGSTGSIGTQTLDIVSQYPDQFRIVGLAAGSNVEMLAEQIRQFRPQIAAISAA
EKLPALQAAIKDLDPQPILLGGEAGVIEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKD
IALANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPKGGLKKILLTASGGA
FRDWDVERLAEVTVSDALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYQDIEIV
IHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTDWERLNLVKAGNLTFRE
PDHQKYPCMQLAYAAGRAGGSMPAVLNAANEQVVALFLDEKIKFLDIPRCIELVCDRHQN
DNCANPSLDDILAADQWARQEVLTATKNLASQPQIISVN
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
attgtgaaaagtattactcttgttggttccactggctcaattggtactcagactctagat
atcgtgagtcagtacccagatcagtttcggattgtggggttagcggcgggaagcaatgta
gaaatgttggcagaacaaattcgccaattccgtccccaaatagcagcgatttctgccgcc
gaaaaattgccagcactccaagcagccattaaagaccttgatccccagccgattttatta
gggggcgaagccggagtgatcgaagttgctcgttatggtgatgctgaaacggtggtgaca
ggtattgtcggttgtgctgggttattgccaaccatcgccgctatagaagctggtaaagat
atcgccttagcaaacaaagaaactctcatcgccggcgggcctgtagttttacccttagta
gaaaagcacggcgttaaattattaccagccgactccgaacattctgccatcttccagtgc
ctccaaggtgtaccaaaaggcggcttaaagaagattttactcacagcttccggtggtgct
tttcgggattgggatgtggaaagattagcagaagtgacggtgtccgatgccctgaaacat
cctaactggtcaatggggcgaaaaattactgtagactcagctaccttaatgaacaaaggc
ttagaagtaattgaggctcactttctgtttgggttagattatcaagatatcgaaattgtc
atccatccccaaagtattattcattcactaattgagctgcaagatacctctgttttagcc
caactcggctggccggatatgcgcttacctttgctatatgctttatcttggcctgaacgc
atctacacagactgggaacgcttaaatttagtcaaagctggcaatctcaccttccgtgaa
ccagaccatcaaaagtatccttgtatgcagttagcttatgctgctggtagggctggtggt
tccatgccggcggtgttaaatgccgcgaatgaacaggttgtggcattattcctggacgag
aaaatcaaatttttagatattccccgttgtatcgaattagtgtgcgatcgccatcaaaac
gataactgtgccaatccttctttagatgatattttggcagcagatcaatgggcaagacaa
gaagttttaacagctactaaaaatttagcaagccaacctcagataatttccgtcaactaa

DBGET integrated database retrieval system