KEGG   Nostoc sp. PCC 7120: alr4385Help
Entry
alr4385           CDS       T00069                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    alr4385 (tpiA)
   01230 Biosynthesis of amino acids
    alr4385 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    alr4385 (tpiA)
   00051 Fructose and mannose metabolism
    alr4385 (tpiA)
   00562 Inositol phosphate metabolism
    alr4385 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    alr4385 (tpiA)
Enzymes [BR:ana01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     alr4385 (tpiA)
Exosome [BR:ana04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   alr4385 (tpiA)
  Exosomal proteins of bladder cancer cells
   alr4385 (tpiA)
  Exosomal proteins of melanoma cells
   alr4385 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5257381..5258106
Genome map
AA seq 241 aa AA seqDB search
MRKIVIAGNWKMFKTQAESQEFLKEFLPALEETPQEREVLLCVPFTDLAILSQSLHGSLV
QLGAQNVHWAENGAYTGEISGPMLTEIGVRYVIVGHSERRQFFGETDETVNLRLQAAQKY
GLTPILCVGETKQQRDSGETESLIVSQLDKDLINVDQTNLVIAYEPIWAIGTGDTCETTE
ANRVIGLIRSQLKNSDVPIQYGGSVKPNNIDEIMAQPEIDGVLVGGASLEAASFARIVNY
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgcggaaaatagttattgccggtaactggaaaatgttcaaaacccaggcagagtctcaa
gagttcttaaaagaatttctgcctgcattagaggaaacacctcaagaacgggaagtgctg
ctttgcgttcctttcactgatctggccattttgtctcagagcttacatggtagccttgta
caactgggagcgcaaaatgtccactgggcagaaaatggagcatacactggtgaaatctct
ggcccaatgttgacagaaattggtgtccgttacgtcattgtcggtcatagcgaacgacga
caattttttggggaaacagacgagacagtgaatttacgtctccaagctgcccaaaagtat
ggtttaacaccaattctttgtgtaggcgaaaccaaacaacagcgagattctggggaaact
gaatcactaattgtcagccaactcgacaaagacctcataaatgttgatcagacaaatttg
gtgattgcctacgaacccatttgggcaataggcactggtgatacttgtgaaacaacagag
gctaatcgagttattggcttaattcgcagccaattgaagaattctgatgtgccgattcaa
tatggtggctcagtcaaaccaaataatattgacgagattatggctcaaccagaaatcgat
ggcgttctcgtgggcggagcaagtctagaagctgcaagtttcgctaggatagtcaactat
ctctaa

DBGET integrated database retrieval system