KEGG   Anabaena sp. PCC7120: alr4386Help
Entry
alr4386           CDS       T00069                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ana  Anabaena sp. PCC7120
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ana00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5258159..5259022
Genome map
AA seq 287 aa AA seqDB search
MCSKLIIGDRCFHWGQRTYLMGILNVTPDSFSDGGKFNTTSAALAQAKALVASGADIIDV
GGQSTRPGAEQITLTEELERVLPIVQILRSQISVPISVDTTRAVVAKASIEAGANIINDI
SGGTFDPQMLPTVATLGVPIILMHIRGTPQTMQQFTDYQDLMGEISSFLANQITTATTLG
IQPEKIIIDPGIGFAKNYEQNLEILRHLRSLRALNCPILVGASRKSFIGRILNQPDPKAR
VWGTTAACCAAIFNGADILRVHDVQEMRDVSLVADALFRGEVLSSEN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagtaaattgatcataggcgatcgctgtttccactggggacagcgtacttattta
atgggcattttaaatgtaacgccagatagttttagtgatggtggtaaatttaatactaca
tctgccgctttagcccaggcaaaagccctagtagcttctggtgctgatattatcgatgtc
ggtggtcaatctactagaccaggcgcagagcaaatcaccctgacagaagaactggagcgg
gtattgccaatagtccagatattgcgatcgcaaatttctgtacccatatcagtggataca
actagggcagtcgtagctaaagcatctatagaagctggagcaaatattattaatgatatt
tctggtggcacatttgacccccaaatgttgcccacagtggcaactttaggcgtgccaatt
atattgatgcacatccgtggtacaccacagactatgcagcaatttaccgattatcaagat
ttaatgggagaaatttctagttttttagctaaccaaattaccacagccacaactttgggt
attcaacccgaaaaaattatcattgatcctggtattggctttgctaaaaactacgaacaa
aatttagaaatactacgccacttacgttcattacgggcgctaaattgtcctattttagta
ggggcatcccgtaaaagttttatcggtcgaattttaaatcaaccagatcccaaagcacga
gtttggggaacgactgcggcttgttgcgctgctattttcaacggagctgatatcctgcga
gtacatgatgttcaagagatgcgtgatgtatccctagttgctgatgcactctttcggggt
gaggtattgagttctgaaaattga

DBGET integrated database retrieval system