KEGG   Anabaena sp. PCC7120: alr4448Help
Entry
alr4448           CDS       T00069                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ana  Anabaena sp. PCC7120
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5333786..5334934
Genome map
AA seq 382 aa AA seqDB search
MFHRRKFLRRAGYTTLSAFLTMGFLQRDKQRDSRSTDIAAINTNYPLRQLAAAKGKRYGA
AVDSETLKKYPDYAKLIARECSIVTPNGELKWNATEPQPGYFTFEAADAIANFCQKHNLK
MHGHTLFWNMAKPDWLPYPPTIPMIERHFNGVMGHYRNSEVLISWDIANEIIAYSEDEAK
ASTYGLHKGVKPELIRDVFLIAASIDSSKKFYLNDFSIEGDTWKSRYFLKMIEYLKNNGA
KIDGAGIQSHLWFSTNYPFDEKGFVGVLKRLKELEVKPVITELDIIIDTPLPDTIEKLDQ
MVADSYKRYLDLCFANGVDTIITWGITDRYSWIRHPDWMPQKFKANPSYHKFLRPLPYDE
NLKPKLARKAIAQAFIKATSSR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttccatcggagaaaattcttaaggagagcagggtacacaactctatctgctttcttg
acgatggggtttttacaaagggataaacagagggatagccgtagtacggatattgccgca
atcaatacgaattatcccttgcggcaattagctgctgccaaaggaaaacgctatggtgca
gcagttgacagtgaaactttaaaaaaatatcccgactacgcgaaattaattgcccgcgaa
tgttcaattgtgacacccaacggcgaattaaaatggaatgccactgaaccgcagccagga
tattttacttttgaagcagctgatgcgatcgctaacttctgccaaaagcataacctgaaa
atgcacgggcataccctgttctggaacatggcaaaaccagactggcttccttatcccccc
accatacccatgatcgaacggcactttaacggtgtgatgggacattatcgcaatagtgaa
gttttaatatcttgggatatcgctaatgaaattattgcctacagtgaagatgaagctaag
gcctctacttacggcttacataaaggtgtaaaaccagaattaattcgagatgtattttta
atcgccgcttcgattgatagcagcaagaagttttacttaaatgatttctccattgaaggc
gatacctggaaatccaggtatttcctaaaaatgatcgagtatcttaagaataatggcgcg
aagatagatggagcaggtatccagtctcatctgtggttttccaccaattatccttttgat
gaaaaaggatttgttggtgttttaaaaaggctcaaagaactggaagttaaaccagtaatt
accgaactggatattattattgacactcctctaccagacactattgaaaagctcgatcaa
atggtagctgactcttataagcgatatcttgacttatgcttcgctaatggagtcgatacc
atcattacctggggtattactgatcgttatagctggatacgtcaccctgattggatgccc
caaaaatttaaggcaaatcccagctaccataagtttttgcgtccacttccctacgacgag
aatctgaaacctaaacttgctcgtaaagcgatcgcccaagccttcataaaggctacttct
tcaagatga

DBGET integrated database retrieval system