KEGG   Nostoc sp. PCC 7120: alr4489Help
Entry
alr4489           CDS       T00069                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    alr4489 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    alr4489 (rfbC)
Enzymes [BR:ana01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     alr4489 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5376114..5376659
Genome map
AA seq 181 aa AA seqDB search
MNFIHTKIPAISLLEPQVFSDSRGLFFESYNQQNFTDKLGITVNFVQDNHSFSQHNVLRG
LHYQIIQPQGKLVRAVVGTIFDVAVDIRKSSPSFGQWVGYELSAENKRQLWVPPGFAHGF
LVLSEVAEVIYKTTDYYAPGGDRTILWNDPDLAINWPLKEPPILSAKDSQGQPFKSAEVY
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcattcatacaaaaattcctgctatttccctcctcgaaccgcaagtcttcagt
gactcacgcggcttattctttgaatcttacaatcagcaaaattttacagataaacttggt
atcaccgtaaacttcgttcaagataaccattcattttcccaacataacgtcctgcgtgga
ctgcactatcaaatcattcaaccccaaggcaaattagtccgcgctgtcgtggggacaatt
tttgatgttgctgtagatattagaaaaagctctcccagtttcggacaatgggtaggttat
gaacttagcgccgagaacaaacgccaattgtgggtacctccaggctttgctcatggcttt
ctcgtactgtctgaagttgccgaagttatttacaaaactacagattactatgcgcctggt
ggcgatcgcactattctatggaatgatcctgatttagcaataaattggcctctcaaagaa
ccaccaattttatcagccaaagatagccagggtcagccatttaaaagtgcggaagtatat
gaatga

DBGET integrated database retrieval system