KEGG   Anabaena sp. PCC7120: alr4682Help
Entry
alr4682           CDS       T00069                                 

Gene name
amt1
Definition
ammonium transporter
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ana  Anabaena sp. PCC7120
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ana00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5582484..5583356
Genome map
AA seq 290 aa AA seqDB search
MKDLQEILAIARAVGWGAAEILQSYYHGTAKDSNLNVQYKQNEPVTVADITVSQYILQKL
QAALGQEDFVYVSEETYKSELSENTKTTTDWVWIIDPLDGTRGFIEKTGDYAVHIALVKE
HRPVLAVVAIPEAEKLYFALKNSGTFVETRNNSDLLQLSLKNTNKSLEDLTIVVSRSHRN
QKLDYLLERLPCQQQKSVGSVGCKIATILEQQADLYISLSGKSAPKDWDIAAPELILTEA
GGKFTHFDGTNLQYSTGDINQWGGLLASNGQYHTELCQKIEKILMQFDEM
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacttacaagagatattagcgatcgctcgtgctgtaggttggggtgcagccgaa
atattacaatcctattatcacggcacagccaaagactcaaatctcaacgtccagtataaa
cagaatgagcctgtcaccgttgccgatatcactgtcagtcaatatattttacaaaagcta
caagctgctttaggacaagaagattttgtctacgtcagcgaagaaacctataaatcagaa
ttatcggaaaatacaaagactacaactgattgggtgtggatcattgaccccttagacgga
acccgtggttttattgaaaaaactggagattacgcagttcatattgctttagttaaagaa
catcgaccagttttagcggtggtagcgataccggaagcagaaaaattatatttcgcgctc
aaaaatagtggtacatttgtagaaacacgcaacaactccgaccttttacaactatcttta
aaaaacacaaacaagtcattagaggatctcacgatagttgtcagccgttctcaccgtaat
caaaagttagactacttactagaaaggttgccttgtcagcagcaaaaatccgtgggtagc
gttggttgcaagatagccactattctagaacagcaagcagacctttacatttccctatcc
ggtaaatctgcacctaaagactgggacatagccgctccagagttaattttgacagaagct
ggtggtaagtttactcattttgacggcacgaacttacaatacagtaccggagacattaat
caatggggtggcttactggctagtaacggccaatatcatacagaactctgccagaaaata
gaaaaaatattgatgcagttcgacgagatgtaa

DBGET integrated database retrieval system