KEGG   Nostoc sp. PCC 7120: alr4682Help
Entry
alr4682           CDS       T00069                                 

Gene name
amt1
Definition
ammonium transporter
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    alr4682 (amt1)
Enzymes [BR:ana01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     alr4682 (amt1)
Transfer RNA biogenesis [BR:ana03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    alr4682 (amt1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5582484..5583356
Genome map
AA seq 290 aa AA seqDB search
MKDLQEILAIARAVGWGAAEILQSYYHGTAKDSNLNVQYKQNEPVTVADITVSQYILQKL
QAALGQEDFVYVSEETYKSELSENTKTTTDWVWIIDPLDGTRGFIEKTGDYAVHIALVKE
HRPVLAVVAIPEAEKLYFALKNSGTFVETRNNSDLLQLSLKNTNKSLEDLTIVVSRSHRN
QKLDYLLERLPCQQQKSVGSVGCKIATILEQQADLYISLSGKSAPKDWDIAAPELILTEA
GGKFTHFDGTNLQYSTGDINQWGGLLASNGQYHTELCQKIEKILMQFDEM
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacttacaagagatattagcgatcgctcgtgctgtaggttggggtgcagccgaa
atattacaatcctattatcacggcacagccaaagactcaaatctcaacgtccagtataaa
cagaatgagcctgtcaccgttgccgatatcactgtcagtcaatatattttacaaaagcta
caagctgctttaggacaagaagattttgtctacgtcagcgaagaaacctataaatcagaa
ttatcggaaaatacaaagactacaactgattgggtgtggatcattgaccccttagacgga
acccgtggttttattgaaaaaactggagattacgcagttcatattgctttagttaaagaa
catcgaccagttttagcggtggtagcgataccggaagcagaaaaattatatttcgcgctc
aaaaatagtggtacatttgtagaaacacgcaacaactccgaccttttacaactatcttta
aaaaacacaaacaagtcattagaggatctcacgatagttgtcagccgttctcaccgtaat
caaaagttagactacttactagaaaggttgccttgtcagcagcaaaaatccgtgggtagc
gttggttgcaagatagccactattctagaacagcaagcagacctttacatttccctatcc
ggtaaatctgcacctaaagactgggacatagccgctccagagttaattttgacagaagct
ggtggtaagtttactcattttgacggcacgaacttacaatacagtaccggagacattaat
caatggggtggcttactggctagtaacggccaatatcatacagaactctgccagaaaata
gaaaaaatattgatgcagttcgacgagatgtaa

DBGET integrated database retrieval system