KEGG   Anabaena sp. PCC7120: alr4733Help
Entry
alr4733           CDS       T00069                                 

Gene name
chlH
Definition
protoporphyrin IX magnesium chelatase
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
ana  Anabaena sp. PCC7120
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ana00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5641382..5645068
Genome map
AA seq 1228 aa AA seqDB search
MKRIVLIAGFESFNADLYRKAAFLANSRCADLDIRVFSDRDITSKRLEVEAALQGADVFF
GSLLFDYDQVVWLRDRVSQIPIRLVFESALELMSLTKLGAFAIGDKPKGMPKPVKFILDK
FSNGREEDKLAGYISFLKIGPKLLKFVPVQKVQDLRNWLIIYGYWNAGGTENVAALFWTL
AEKYLDLKIGDIPPPIETPNIGLLHPDYPGFFESPREYLAWYQKREEAGVQGAGCRGEKN
PVVGILLYRKHVITKQPYIPQLIRRFEDAGLIPLPIFINGVEGHVAVRDWMTTDYEFQQR
QIGNIATPSLSPEAVKVDAIVSTIGFPLVGGPAGSMEAGRQVEVAKRILTAKNVPYIVAA
PLLIQDIHSWTRQGVGGLQSVVLYALPELDGAIDTVPLGGLVGEDIYLVPERVQRLIGRV
KSWIALRQTPAAERKIAIILYGFPPGYGATGTAALLNVPRSLIKLLHALKDQGYNVGDIP
EDGEELIRLVKETDEEMERWEKNKPFPSSANTVNSRKLEKWLGYLRTSRIEKQWKSLTGS
GIKTYGDELHVGGVQLGNVWIGVQPPLGIQGDPMRLMFERDLTPHPQYAAFYKWLQNDLQ
ADAVVHFGMHGTVEWLPGSPLGNTGYSWSDILLGDLPNLYIYAANNPSESILAKRRGYGV
LISHNVPPYGRAGLYKELITLRDLIAEYREDPNKNYVLKEAICKKIVDTGLDTDCPFEDA
KRLGIPFTPENIRMFSAHAFDDYLVKLYEYLQVLETRLFSSGLHTLGEAPNQEELASYLE
AYFGEEQAKQPEMEKQITDLLMQTTDELTNLLRGLNGEYIPPAPGGDLLRDGAGVLPTGR
NIHALDPYRMPSPAAYERGREIAQKIIAQHLQEHHTYPETVAVLLWGLDAIKTKGESLGI
LLELVGAEPVKEGTGRIVRYELKPLAEVGHPRIDVLGNLSGIFRDSFVNIIELLDDLFQR
AADADEPEDQNFVRKHALALKAQGVENASARLFSNPAGDFGSLVNDRVVDGNWESGEELG
NTWQSRNVFSYGRQDKGQARPEVLQQLLKTSDRIVQEIDSVEYGLTDIQEYYANTGGLKK
AAEKQSGKKVTASFVESFSKDTTPRNLEDLLRMEYRTKLLNPKWADAMASQGSGGAYEIS
QRMTALIGWGGTADFKDDWVYDQAADTYALDPEMAEKLRQANPEAFRNILSRMLEAHGRG
LWQADTDKLDKLRQLYELTDEQLEGVTV
NT seq 3687 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcgttttgattgctggatttgaatcatttaatgctgacttgtacagaaag
gctgcctttttggctaattctcgctgtgctgatttagatattcgtgtgtttagcgatcgc
gatattaccagcaagcgcctagaagtggaagcggcattgcaaggcgcggatgtgtttttt
ggtagcctactatttgattatgaccaagttgtgtggttgcgcgatcgtgtttcccaaatt
cctatccgcttagtattcgagtcagccttggagttgatgagtttaactaagctgggtgct
tttgccattggtgataaaccaaagggaatgcccaaacctgttaaatttattctcgacaaa
tttagcaacggacgagaagaagacaaacttgctggttatattagctttttaaaaatcggc
cccaaactcctcaaattcgttcccgtgcagaaagtccaagacttacgcaactggttaatt
atctatggttattggaacgccggcggcactgaaaacgtggctgctttattttggacacta
gcagaaaaatatttagatttaaaaatcggtgacattcccccaccaatcgaaacccccaac
ataggtttattgcatcccgattatccagggttttttgaatccccacgcgaatatttggca
tggtatcaaaagagggaagaggcaggggtgcagggggcagggtgcaggggggaaaaaaac
cctgttgttggtattcttctttaccgtaaacacgtcattaccaaacaaccctatattccc
caactgattcgccgctttgaagatgcgggtttaatccccttacccatatttatcaacggc
gtagaaggacacgttgcggtacgggattggatgactaccgactatgaatttcagcaacga
caaatcggtaatatcgccacaccttcactatctccagaagccgttaaagttgatgcaatt
gtttccaccattggctttcccctggtcggtggcccggctggttcaatggaagcaggtcgt
caagtagaagtagccaagcgcatcctcaccgccaaaaatgtcccttacatcgtcgctgca
cctttattaattcaagatatccattcatggacacgtcaaggtgtgggtggtttgcaaagc
gtggtgttatacgccttaccagaattagacggtgcaattgatactgttccccttggtggt
ttggtgggtgaagatatttatttagttcctgaacgggtacagcgcctcattggtagagtt
aaaagctggattgctttacgtcaaacaccagcagcagaacggaaaattgccattatctta
tatggcttccctcctggttatggggctacgggtacggctgcattattaaatgttccccgc
agtttgattaaattactccacgccctcaaagaccaaggttataacgtcggcgatatccca
gaagatggggaagaattaattcgtctggtgaaggaaactgatgaagagatggaaagatgg
gagaaaaataaaccttttccctcttcagctaatactgttaattcccgtaaattagaaaaa
tggttaggatatctccgcacttcccgcatcgaaaaacaatggaagtctttgacaggtagc
ggaattaaaacttatggtgatgaactccatgttggtggtgtgcagttagggaatgtgtgg
ataggtgtccagccaccattggggatacaaggcgaccccatgcgcctgatgtttgaacgt
gatttaacaccccatccccaatatgctgccttttataaatggttgcaaaatgatttacaa
gctgatgctgttgtccattttggaatgcacgggactgtagaatggttacctggttcacct
ttgggtaatactggttattcgtggtcggatattttgttaggagatttgcccaatctatat
atatatgcggcaaataatccttctgagtcgattttggccaagcgtcgcggttatggggtg
ctaatttctcacaatgtccccccctatggtcgtgctggtttatataaggaattaattaca
ctgcgcgatttaattgcggaatatcgagaagaccccaacaagaattatgttctcaaagaa
gcgatttgtaaaaagattgttgatacgggtttagacacagattgcccttttgaagatgcc
aaacgtttgggtattcccttcactcctgaaaatatcaggatgtttagcgcccatgctttt
gatgattatctggtgaaattatatgagtatttgcaagttttagaaactcggttattttcc
tctggcttacatacattaggtgaagcaccaaatcaagaagaattagcatcttatctcgaa
gcttattttggtgaagaacaagcaaaacaaccagaaatggaaaagcaaattacagatttg
ttgatgcaaaccacagatgaattaactaatttactacgcggattaaatggtgaatatatt
cctccagcaccgggaggggatttattacgagatggcgctggtgtgttacctacagggaga
aatattcatgctttagacccctatagaatgccatcccccgcagcttatgaacggggtcga
gaaattgctcaaaaaatcatcgctcagcatttacaagaacatcatacatatcctgaaacg
gtggcggttttattgtggggattagatgcaattaaaactaagggtgaatctttggggatt
cttttagaattagttggggctgaacctgtgaaagaaggaacaggtcggattgttcgttat
gaattaaagcctttagcagaggtcggacatccgcgcattgatgtattaggaaatctatca
gggatttttagagatagtttcgtcaacatcatcgaattattagatgatttatttcaaagg
gctgctgacgctgatgaaccagaagaccagaattttgtgagaaaacacgctttagcttta
aaagcccaaggtgtagaaaatgcttccgcgagattattttccaatcctgcgggggatttt
ggttctttggtcaatgatagagttgttgatggtaactgggaatctggggaagagttaggt
aatacttggcaaagtcgcaatgtgtttagctatggcagacaagacaaaggacaagctaga
ccggaagttttgcagcaattattgaaaacgagcgatcgcatcgttcaagaaatagattcg
gtagaatatggtttaaccgatattcaagaatattacgccaacaccggcggtttgaaaaaa
gcagccgaaaagcaaagcggtaagaaagttacggctagctttgtggaaagtttttccaaa
gacaccacaccccgcaacttagaggatttattgcggatggaataccgcaccaagttactc
aatcccaaatgggctgatgcaatggcgagtcaaggttccggtggtgcttacgaaatttcc
caacgcatgacagccttaattggttggggtggtacggctgattttaaagatgattgggtt
tatgaccaggctgctgatacttatgctttagaccccgaaatggcagagaaattacgccaa
gccaacccagaagcttttcgtaatatcctcagcaggatgttagaagcgcatggacggggt
ttatggcaagctgatacagataagttagataagttgcgtcagttgtatgaattgactgat
gaacaattagaaggcgtaacggtttaa

DBGET integrated database retrieval system