KEGG   Nostoc sp. PCC 7120: alr4811Help
Entry
alr4811           CDS       T00069                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    alr4811 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    alr4811 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    alr4811 (trpA)
Enzymes [BR:ana01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     alr4811 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5729170..5729970
Genome map
AA seq 266 aa AA seqDB search
MTAISDRFETLKQNQECALIPFITAGDPDLETTAAALKILDSNGADFIELGIPYSDPLAD
GPVIQAAATRALQNGTKLERVLEMLKATIPSLRAPIILFTYYNPILHRGIDKFLEQIAAV
GVAGLVVPDLPLEEAAGLLKPATERGIDLILLIAPTSSSERIEAIAHSSQGFIYLVSVTG
VTGVRSQVEVRVSDLLRQIRQVTDKPIAVGFGISQPEQATQVKEWGADGAIVGSAFVQRL
SAGTPAEGLSAIAEFCQSLKAAIKTS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccatttccgatcgctttgaaaccctcaaacagaatcaagagtgcgctctaatt
ccgtttattactgctggtgatcctgatttagaaactacagccgcagccttaaagatttta
gatagcaatggtgctgattttatcgaattgggtatcccttattcagatcctttggcagat
ggaccagtaattcaagcagccgctacccgcgctttacaaaatggtacaaagctggaaagg
gtactggagatgttaaaagctactattcccagtttaagagcgccaattattttatttacc
tactacaatcccattttgcatcggggaattgacaagtttctggaacaaatcgcggcggtt
ggtgtagccggtttagtagtgcctgatttaccgctagaagaggccgcaggactacttaaa
ccggctactgaacgggggattgatttaattctattgattgcccctacaagttcatctgag
cgaatagaagcgatcgctcattcttctcaagggttcatctatttggtcagtgtcacaggt
gttacaggggtgcgatcgcaagtagaagtccgtgtatctgatttattacgacaaattcgt
caggtcacagacaagcccattgctgtaggtttcggcatttctcaaccagaacaagccacc
caggtgaaagagtggggagccgatggggcaattgtcgggagcgcctttgtccaacgttta
agcgcaggaacaccagcagaaggactcagtgcgatcgcggaattttgtcaaagtctgaag
gcagccatcaaaacatcttga

DBGET integrated database retrieval system