KEGG   Nostoc sp. PCC 7120: alr4977Help
Entry
alr4977           CDS       T00069                                 

Gene name
recR
Definition
(GenBank) recombination protein
  KO
K06187  recombination protein RecR
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ana00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    alr4977 (recR)
DNA repair and recombination proteins [BR:ana03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     alr4977 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      alr4977 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 Toprim
Motif
Other DBs
NCBI-ProteinID: BAB76676
CyanoBase: alr4977
CYORF: alr4977
UniProt: Q8YMF7
Position
5942015..5942341
Genome map
AA seq 108 aa AA seqDB search
MIALEKTREFKGKYHVLGGVISPMDGIGPEQLTITPLLRRVSQQQPKEVILAISPSVEGE
TTTLYVGQLLKPFTKVTRIAFGLPVGGDLEYADEITLARALEGRRELD
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
gtgattgccctagagaaaacccgcgaattcaaaggtaagtatcatgtcctgggtggggtg
atttcgccaatggatggaattggcccagaacagttgaccataactcctttgttgcggaga
gtcagtcagcagcaaccaaaagaagtaattttggcaattagtcccagcgtcgaaggggaa
accacaacattgtatgttggtcaactcttgaaaccatttactaaagtgacaagaattgcc
tttggtttgcccgtaggcggagatttagaatacgctgatgagataacattggcaagagct
ttagaaggacgtagagaattagattaa

DBGET integrated database retrieval system