KEGG   Nostoc sp. PCC 7120: alr4977Help
Entry
alr4977           CDS       T00069                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
ana  Nostoc sp. PCC 7120
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ana00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    alr4977 (recR)
DNA repair and recombination proteins [BR:ana03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      alr4977 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5942015..5942341
Genome map
AA seq 108 aa AA seqDB search
MIALEKTREFKGKYHVLGGVISPMDGIGPEQLTITPLLRRVSQQQPKEVILAISPSVEGE
TTTLYVGQLLKPFTKVTRIAFGLPVGGDLEYADEITLARALEGRRELD
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
gtgattgccctagagaaaacccgcgaattcaaaggtaagtatcatgtcctgggtggggtg
atttcgccaatggatggaattggcccagaacagttgaccataactcctttgttgcggaga
gtcagtcagcagcaaccaaaagaagtaattttggcaattagtcccagcgtcgaaggggaa
accacaacattgtatgttggtcaactcttgaaaccatttactaaagtgacaagaattgcc
tttggtttgcccgtaggcggagatttagaatacgctgatgagataacattggcaagagct
ttagaaggacgtagagaattagattaa

DBGET integrated database retrieval system