KEGG   Nostoc sp. PCC 7120: asr2953Help
Entry
asr2953           CDS       T00069                                 

Definition
(GenBank) 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00790  Folate biosynthesis
ana01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    asr2953
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     asr2953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK Nre_C
Motif
Other DBs
NCBI-ProteinID: BAB74652
CyanoBase: asr2953
CYORF: asr2953
UniProt: Q8YSX6
Position
3595614..3595853
Genome map
AA seq 79 aa AA seqDB search
MRQERWGPRSLDLDLLLYDDLIIDTPTLQIPHPRMQERAFVLVPLAEIAPDWLEPISGYV
IRELVKKVDCSDVHLLKGS
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcaagagcgctgggggccgcgatcgctagacttggatttgttattgtatgatgac
ttaattattgatacaccaactctccaaataccccatccgcgaatgcaagagcgagccttt
gttttagtacctctagcggagattgcgcccgactggttagaaccaatttccggatatgta
attagagaactggtaaaaaaggtagactgttctgatgtacatttgttaaagggcagttaa

DBGET integrated database retrieval system