KEGG   Anabaena sp. 90: ANA_C10167Help
Entry
ANA_C10167        CDS       T02341                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
anb  Anabaena sp. 90
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:anb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:190898..192094
Genome map
AA seq 398 aa AA seqDB search
MKAITLLGSTGSIGTQTLDIVSEHPDKFRIVGLSAGRNVELFAAQIRQFRPQIAAISAAE
KLPELKEAIKDLNPQPILLAGEAGVIEVARYGDSQTVVTGIVGCAGLLPTIAAIEAGKDI
ALANKETIIAGAPVVLPLVKKHGVKLLPADSEHSAIFQCLQGVPKDGLRKILLTASGGAF
RDWPVEKLPEVKVADAIKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGVDYDNIEIVI
HPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTNWERLNLVKSGDLTFREP
DHHKYPCMGLAYAAGKAGGSMPAVLNAANEQAVALFLEEKIHYLDIARCIEFVCDRHQND
NTQNPSLDDILNADKWARQEVFTAMKKVATQPQIISVG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctattactttactgggttctactggctcaattgggacgcaaaccttagatatc
gtctctgaacaccccgataaattccgcatcgttggattgtccgctggacggaatgtggag
ctattcgcggcgcaaattcgccagtttcgtccccaaattgccgccatttctgctgctgaa
aagttaccggaactcaaagaagccattaaagacttaaatcctcagcccattttactggct
ggggaagcgggagtcatagaagttgctcgttatggcgattctcaaacagtagttactggt
attgttggttgtgctggcttattaccgaccattgcagctattgaagcggggaaagatatt
gctttagccaataaagaaactatcattgctggcgctcctgtggtgttacctttggtgaaa
aaacacggggtgaaactattaccagcagattccgaacattctgctatttttcaatgtttg
caaggtgttcctaaagatggtttacggaaaatattacttactgcttccggtggtgctttt
cgagattggcctgtggaaaagttaccagaggtaaaggttgctgatgctattaaacatcct
aactggtcaatggggcgaaaaatcacggtagattcggcaactttgatgaataagggttta
gaagtaattgaagctcattatttatttggagtagattacgataacatcgaaattgtcatt
catcctcaaagtattattcactcgttaatagaattacaagatacgtctgttttagctcaa
cttggttggccagatatgcgtttacctttgctttatgctttatcttggccggagcgaatt
tacactaattgggaaagattgaatttagttaaatctggtgatttaactttccgtgaacca
gatcatcacaaatatccttgtatgggtttggcttatgctgcgggtaaggctggtggttct
atgccggcggtgttgaatgcggctaatgaacaagctgtggcgttatttttagaagagaaa
attcactatttggatattgctcgctgtattgaatttgtctgcgatcgccatcaaaatgat
aacacacaaaatccctctttagatgacattttaaatgctgataaatgggctagacaagaa
gttttcacagctatgaaaaaggtagcaactcaaccacagataatttctgttggttaa

DBGET integrated database retrieval system