KEGG   Anabaena sp. 90: ANA_C10239Help
Entry
ANA_C10239        CDS       T02341                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
anb  Anabaena sp. 90
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ANA_C10239
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ANA_C10239
Enzymes [BR:anb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ANA_C10239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:271038..272030
Genome map
AA seq 330 aa AA seqDB search
MPTTWNRHHILTLADFTTAEYNAVLQTAASFQEVLSRRTKKVPTLQGQVVANLFFEPSTR
TRSSFEIAAKRLSADTLNFAAATSSMTKGETILDTAKTYLAMGTDIMVVRHKDAGVPQAI
AQEMDRLGVKVSVLNAGDGQHEHPSQGLLDLFTICSLIDPAQPKIESLQGKKIAIVGDIL
HSRVARSNIWSLIASGAEVHLSAPPTLLPKFFAEYLGCTENSNRLFTHWQLEPALENADF
VMTLRLQKERMTAHLFPSLREYHQLFGITRAKLKLCKPQVKVLHPGPVNRGVEISSDLMD
DPEFSLIQSQVTSGVAVRMALLYFIGSGRA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcctactacttggaatcgtcatcatattctcacacttgctgacttcacaacggctgaa
tataacgccgtgttacaaactgcggcttcttttcaagaggtactatcccgacggacaaag
aaagtccccactttacagggacaggtagtagcaaatttattttttgaaccttctacccgc
acgcgcagtagttttgaaattgcggcaaaaagacttagtgcggataccctcaactttgcc
gcagctacatcttctatgaccaaaggtgaaacaattcttgacacagcaaaaacctatttg
gcaatgggaactgatattatggtagtccgccataaggatgcaggagttccgcaagcgatc
gcgcaagaaatggatcgtttaggtgtaaaagttagcgtcctcaatgccggtgatggacaa
catgaacatccatctcaaggattattagatctatttacaatttgtagtttaattgaccct
gcacaacccaaaattgaatcattacaaggtaaaaaaattgctattgttggcgatatttta
cactctcgtgtagcccgttctaatatttggagtttaatcgctagtggtgcagaagtacat
ctgtccgcacctcccacattgttacctaaattctttgcagaatacttaggatgtacagaa
aactctaaccgattatttacccattggcaattagaaccagctttggaaaatgctgatttt
gtcatgactttgcgcttacaaaaagaacgcatgaccgcccatttattccctagtttaaga
gaatatcatcaactatttggcattactcgtgctaagttaaaactatgtaaacctcaagtt
aaagtattgcatccaggtccagtaaatcggggtgtggaaattagttctgatttaatggat
gatcctgaattcagcttaattcaatctcaggtaactagcggtgtagcagtgcggatggca
cttttatattttatcggtagtggtagggcttaa

DBGET integrated database retrieval system