KEGG   Anabaena sp. 90: ANA_C10239Help
Entry
ANA_C10239        CDS       T02341                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
anb  Anabaena sp. 90
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:anb00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:anb00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:271038..272030
Genome map
AA seq 330 aa AA seqDB search
MPTTWNRHHILTLADFTTAEYNAVLQTAASFQEVLSRRTKKVPTLQGQVVANLFFEPSTR
TRSSFEIAAKRLSADTLNFAAATSSMTKGETILDTAKTYLAMGTDIMVVRHKDAGVPQAI
AQEMDRLGVKVSVLNAGDGQHEHPSQGLLDLFTICSLIDPAQPKIESLQGKKIAIVGDIL
HSRVARSNIWSLIASGAEVHLSAPPTLLPKFFAEYLGCTENSNRLFTHWQLEPALENADF
VMTLRLQKERMTAHLFPSLREYHQLFGITRAKLKLCKPQVKVLHPGPVNRGVEISSDLMD
DPEFSLIQSQVTSGVAVRMALLYFIGSGRA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcctactacttggaatcgtcatcatattctcacacttgctgacttcacaacggctgaa
tataacgccgtgttacaaactgcggcttcttttcaagaggtactatcccgacggacaaag
aaagtccccactttacagggacaggtagtagcaaatttattttttgaaccttctacccgc
acgcgcagtagttttgaaattgcggcaaaaagacttagtgcggataccctcaactttgcc
gcagctacatcttctatgaccaaaggtgaaacaattcttgacacagcaaaaacctatttg
gcaatgggaactgatattatggtagtccgccataaggatgcaggagttccgcaagcgatc
gcgcaagaaatggatcgtttaggtgtaaaagttagcgtcctcaatgccggtgatggacaa
catgaacatccatctcaaggattattagatctatttacaatttgtagtttaattgaccct
gcacaacccaaaattgaatcattacaaggtaaaaaaattgctattgttggcgatatttta
cactctcgtgtagcccgttctaatatttggagtttaatcgctagtggtgcagaagtacat
ctgtccgcacctcccacattgttacctaaattctttgcagaatacttaggatgtacagaa
aactctaaccgattatttacccattggcaattagaaccagctttggaaaatgctgatttt
gtcatgactttgcgcttacaaaaagaacgcatgaccgcccatttattccctagtttaaga
gaatatcatcaactatttggcattactcgtgctaagttaaaactatgtaaacctcaagtt
aaagtattgcatccaggtccagtaaatcggggtgtggaaattagttctgatttaatggat
gatcctgaattcagcttaattcaatctcaggtaactagcggtgtagcagtgcggatggca
cttttatattttatcggtagtggtagggcttaa

DBGET integrated database retrieval system