KEGG   Anabaena sp. 90: ANA_C10496Help
Entry
ANA_C10496        CDS       T02341                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
anb  Anabaena sp. 90
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:anb01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:anb00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:528291..529400
Genome map
AA seq 369 aa AA seqDB search
MTKTIVVKIGTSSLTQPETGQLALSSIATLAETLCDLRRQGHRVILVSSGAVGVGCARLG
LTERPKTIALKQAVAAVGQGRLMRIYDDLFSILQQPIAQVLLTRADLVQRSRYLNANNTF
QELLALGVIPIVNENDTVAVEELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSADPRS
VPDAKPISLVSSMQELTDLQIQTGGQGSQWGTGGMMTKISAARIAIAAGIRTVITQGQFP
RNIEKIIQGELIGTHFAPQPEPTSARKRWIAYGLIPGGKLHLDAGAIAAVVKAGKSLLAA
GIRAVEGEFDNQEAVQLCDSNGQEIARGLVNYNSEELQKICGRQSREIPAILGYEKADTV
IHRDNLVLI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaacaatcgttgttaaaatcggtacttctagtctcactcaaccagaaaccgga
caattagccctttctagcattgctactttagcggaaactctttgtgatttgagacgacag
ggacatcgagtaattttagtttcctccggtgctgtgggagtaggttgtgcgcggttaggt
ttaacggaacgtcccaaaactatagctttaaaacaggctgtagcagcagttggacagggt
agattaatgcgtatatatgatgatttatttagtattttgcaacaaccaattgctcaagta
ttattaacaagggcagatttggtacagcgtagccgctatcttaatgctaataatactttt
caagaattactagctttgggagtaattcctattgttaatgaaaatgatacagtagctgtg
gaagaattaaaatttggagataatgataccctttctgcattagtagccagtttagtagaa
gcagattggctgtttttattaacagatgttgatagattatattcagccgatcctcgttct
gtacctgatgctaaaccgattagtttagttagcagtatgcaagaactgacagatttacag
attcaaactggtggacagggttctcaatgggggactggggggatgatgactaaaatttct
gcggccagaattgcgatcgcggctggtatccgcacagtcattacccaaggacagtttccc
cggaacattgaaaaaattatccaaggggaactcatcggtacacactttgcaccccaacca
gaaccaacttcagcccgcaaacgctggatagcttatggtttaattcctgggggaaaatta
catttagatgcgggagcgatcgccgctgttgtcaaagccggaaaatccctattagcagca
ggaattagagccgtagagggggaatttgacaatcaagaagcggtgcagttatgtgatagt
aatggtcaggaaattgctagaggattggtgaattataatagtgaggaattgcagaaaatt
tgcggccgacagtcacgggaaataccagcaattttaggttatgagaaggcagatactgtg
attcaccgagataatttagttttgatttaa

DBGET integrated database retrieval system