KEGG   Anabaena sp. 90: ANA_C10673Help
Entry
ANA_C10673        CDS       T02341                                 

Definition
magnesium chelatase H subunit (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
anb  Anabaena sp. 90
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ANA_C10673
Enzymes [BR:anb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ANA_C10673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:727922..731908
Genome map
AA seq 1328 aa AA seqDB search
MFTQVKSTIRHIAPDDLRGRKLIKVVYVVLESQYQSALSQAVREINANHPSVAIEISGYL
IEELRNSENYEELKRDIASANIFIASLIFIEDLAQKVVAAVEPHRDNLDVSVVFPSMPEV
MRLNKMGSFSLAQLGQSKSVIANFMKKRKEKSGAGFQDGMLKLLRTLPQVLKFLPMEKAQ
DARNFMLSFQYWLGGSAENLENFLLMLADKYVLKGVEKESFAAAKYEAPVVYPDMGIWHP
LAPTMFEDVREYLNWYSARKDISSNLKDPLAPCVGLVLQRTHLVTGDDAHYVAIVQELES
LGARVLPVFAGGLDFSKPIEAYFYEPITKMQLIDAVVSLTGFALVGGPARQDHPKAIEAL
KRLNRPYMVALPLVFQTTEEWLDSDLGLHPIQVALQIAIPELDGAIEPIILSGKDGATGR
AIALQDRVEIVAQRALKWANLRRKPKLDKKVAITVFSFPPDKGNVGTAAYLDVFGSIFEV
LQGLRNNGYDVQDIPANAQELLEQVIHDAQAQYNSPELNVAYKMSVPEYEALTPYSQRLE
ENWGPPPGNLNSDGQNLLIYGKQFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFAAYY
TYLERIWGADAVLHFGTHGSLEFMPGKQMGMSGDCYPDQLIGSIPNLYYYAANNPSEATI
AKRRSYAETISYLTPPAENAGLYKGLKELSELIASYQTLKDTGRGVSIVNSIMDKCRIVN
LDKDIELPETDSKDMSSEERDNIVGSVYRRLMEIESRLLPCGLHVIGKPPSAEEAIATLV
NIASLDRQEEEIQGLPGIIARSLGRTIEDIYRNNDAGILADVQLLQDITLATRAAVTALV
QEQIDAEGRVIAVSKLNFFNMGRKEPWVESLHQSGYPKVDTSALKPLFEYLEFCLKQVCA
DNELGGLLQGLAGEYILPGPGGDPIRNPDVLPTGKNIHALDPQSIPTSAAVQSAKIVVDR
LLERNKSENEGNWPETIACVLWGTDNIKTYGESLAQIMWMIGVRPVPDALGRVNKLELIP
LSELGRPRIDVVINCSGVFRDLFINQMNLLDQGVKMAAEADEPLEMNFVRKHALKQAEDM
GINLRQAATRVFSNASGSYSSNINLAVENSTWDSEAELQEMYLKRKSFSFNSDNPGVMDE
SREIFETTLKTADATFQNLDSSEISLTDVSHYFDSDPTKLVASLRADGKKPSSYIADTTT
ANAQVRTLSETVRLDARTKLLNPKWYEGMLSHGYEGVRELSKRLVNTTGWSATAGAVDNW
IYEDTNETFIKDEEMQKRLMNLNPHSFRKIVSTLLEMNGRGYWETSEENLDRLRELYQEV
ENRIEGIE
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
atgtttacccaagtcaagtccacgattcgacatattgcacctgacgatttacggggacgt
aaattaatcaaggttgtctatgtcgtgcttgaatcccaataccaaagtgcattatcgcaa
gcggtacgggaaattaacgctaatcatcccagcgtagccatagaaatcagtggatacttg
attgaagaactacgcaactctgaaaactatgaagagttgaaacgcgatatagccagtgct
aatatattcattgcttctctgatttttattgaagacttagcacagaaagtagttgccgca
gttgaaccccatcgtgataacctagatgtgtcggttgtcttcccctccatgcccgaagtt
atgcgcctcaataaaatgggtagcttctctttggcgcaattaggacaatccaagagcgta
attgctaacttcatgaaaaagcgcaaagaaaaatctggcgctggtttccaagacggaatg
ttgaagttattgcggactcttccccaagtgctgaaattcctccccatggaaaaagcacaa
gacgcgagaaacttcatgctcagttttcagtattggctaggtggttcagcggaaaacctg
gaaaacttcttgctgatgctggctgataaatacgtattgaaaggcgtagaaaaagaaagt
tttgctgctgctaagtatgaagcaccagttgtttatcccgacatgggaatttggcatcct
ttagcgccgactatgtttgaggatgtgcgagaatatctgaactggtattctgctcgcaag
gacatttctagtaacctgaaagacccccttgcaccctgtgtaggtttggttttacaacga
actcacctcgttactggtgatgatgcccattatgtggcaattgtgcaggaattggaatca
ttaggggcaagagttctccctgtttttgcaggtggtttagatttctctaaaccgatagaa
gcttacttctatgaaccaattaccaaaatgcagttaatagatgcggtggtatctttaact
ggtttcgctttggtgggtggacccgctagacaggatcatcctaaagccattgaagcatta
aaacggttaaatcgtccttacatggttgccttgcctttggtcttccaaaccaccgaagaa
tggctagatagcgatttggggttacatcccattcaagtggctttacagattgctatacct
gaactagacggcgcaattgagccaatcatcctatcaggtaaagatggggcaacaggcaga
gcgatcgctttacaagatagagtagaaatagttgctcaacgcgccttaaaatgggcaaat
ctgcgccgcaaacccaaactagacaagaaagttgccatcaccgttttcagcttccctccc
gacaaaggtaacgtgggtacagccgcatatttagacgtattcggttctattttcgaggtt
ttacaaggactcagaaacaacggttacgacgtgcaagacattcctgcaaacgcccaagag
ttgctagaacaagtcatccacgacgcacaagcacaatacaacagccccgaactcaacgtt
gcttacaaaatgtctgtgccagaatatgaagcactgacaccttactcccaacgcttagaa
gagaactggggaccacctcccggaaacctcaacagcgatggacaaaatctgttgatttat
gggaaacaatttggtaatgtgttcattggtgtccagccaacatttggttatgaaggcgac
cccatgcggttgttattctcccgttccgcaagtccccaccacggttttgcagcttactac
acctatctagaacggatttggggtgctgatgctgtgttacactttggtactcatggctcg
ttggaatttatgcccggtaagcaaatgggaatgtctggtgattgttacccagatcaacta
attggctcaattcctaacctgtattattacgcagctaataaccccagtgaagccacaatc
gctaaacgtcggagttatgcagaaacaatttcttacctgacaccacctgcggaaaatgct
ggtttatacaagggtttgaaagaactcagcgagttaattgcttcttaccaaactttgaaa
gacactggccggggcgtttccattgtcaattccatcatggataaatgccgcattgtcaac
ttagacaaggatattgagttaccagaaaccgattctaaggatatgtcctcggaagaacgg
gataacattgttggtagcgtttatcggcggttgatggagattgaatcgcgcttattacct
tgtggactgcacgtgattggtaagcctcctagtgccgaagaagcgatcgcaactttggtc
aatatagctagtttagatcgacaagaggaagaaattcaaggtttaccgggaattattgcc
agaagtctgggacgcaccattgaggatatctacagaaacaatgatgccggaattttggca
gatgtgcaattattacaagatatcaccctcgctactcgtgcggctgttacagccttagtt
caagaacaaattgacgcagaaggtcgagttatcgcggtttccaagttgaatttcttcaat
atggggagaaaagaaccttgggtagaatcactgcatcaatcaggttatcccaaagttgac
acctctgcattaaaacctctgtttgaatatttggaattctgcttaaaacaagtttgtgca
gataacgaactgggtggacttctccaaggtttagccggtgaatatattctccctggtccc
ggtggagatcctatccgtaatcctgacgtattacccactggtaaaaatattcacgcttta
gatccccaatctatccccacttccgccgcagtccaatctgcgaaaatcgtcgtggatagg
ttgttggaacggaacaagtcagaaaatgaaggaaactggccagaaaccattgcctgtgtc
ctctggggtacagataacatcaaaacctacggcgaatccctcgcccaaattatgtggatg
attggtgtgcgtccagtacccgatgctttgggacgggtgaataagttggaattgatacct
ttatcagagttgggtcgtcctagaattgatgttgtaattaactgttctggtgtattccgc
gacttgttcattaaccaaatgaatttgctagaccaaggtgtaaaaatggctgcggaagct
gatgaacctttggaaatgaattttgtccgcaagcacgctttgaaacaagcggaggacatg
ggcataaatctgcgtcaagctgcaactcgcgttttctctaatgcttctggttcttattct
tctaatattaacttagcggtggagaatagcacttgggatagtgaagctgagttacaggaa
atgtatttgaaacggaaatctttctctttcaattctgataatcctggggttatggatgag
tcgcgggagatttttgaaactactttgaaaactgctgatgcaactttccagaatctcgat
tcttcggaaatcagtttaacagatgtttcccactattttgactcagatccgactaagtta
gtagcaagtctgcgtgcagatggtaagaaaccatcttcttacattgcagatacaactaca
gcgaatgcacaggtgagaactttatcagaaactgtgcgtttagatgcgcggacgaagttg
ttaaaccccaaatggtatgaggggatgttatctcacggttacgaaggtgtgcgcgaactt
tctaagcggttggtaaatactactggttggagtgcgactgctggcgctgtggataactgg
atttatgaggacacgaacgaaactttcatcaaagatgaggaaatgcaaaagcgtctcatg
aatctcaatcctcattctttccgcaagattgtttctactttgttggaaatgaatggacgc
ggttattgggaaactagcgaggagaatttggatcggttacgtgagttgtatcaggaggta
gaaaaccggattgagggaattgagtag

DBGET integrated database retrieval system