KEGG   Anabaena sp. 90: ANA_C11037Help
Entry
ANA_C11037        CDS       T02341                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
anb  Anabaena sp. 90
Pathway
anb00010  Glycolysis / Gluconeogenesis
anb00052  Galactose metabolism
anb00500  Starch and sucrose metabolism
anb00520  Amino sugar and nucleotide sugar metabolism
anb00521  Streptomycin biosynthesis
anb01100  Metabolic pathways
anb01110  Biosynthesis of secondary metabolites
anb01120  Microbial metabolism in diverse environments
anb01130  Biosynthesis of antibiotics
anb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANA_C11037
   00052 Galactose metabolism
    ANA_C11037
   00500 Starch and sucrose metabolism
    ANA_C11037
   00520 Amino sugar and nucleotide sugar metabolism
    ANA_C11037
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ANA_C11037
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ANA_C11037
Enzymes [BR:anb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ANA_C11037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFW93824
UniProt: K7W223
Position
chANA01:complement(1176289..1177314)
Genome map
AA seq 341 aa AA seqDB search
MTLLLAGDIGGTKTILRLVELSETLELKTLYEESFRSGDFPDLVPIVQKFLSTANSSTPE
KACFAIAGPVVENTAKLTNLAWFLDTNRLTQELGILSISLINDFAAVGYGIFGLTKQDLL
TLQVGKYQPAAPMAVIGAGTGLGQGFLIKQDHQYQVFPSEGGHADFAPRNELEFQLLKYL
VDKHNIQRVSVERVVSGLGITSIYQFLRDRKIATESPEIAQAVRTWEQEAGKAEKTIDPG
AFIGSAALEKSDRLSEQTMQLFVEAYGAEAGNLALKLLPYGGLYIAGGIAPKILPLMQNG
SFLTNFTQKGRMGSLLEEIPVHIILNQQVGLIGAALSASRL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacattgctactggccggagacataggcggaacaaaaactattttgcgtttggtggaa
ctttcggaaacactagagttaaaaactctgtatgaggaaagtttccgcagtggagatttt
cctgatttagttcctatagtgcaaaagtttttgagtacagctaattctagcacaccagaa
aaggcttgttttgcgatcgccggaccagtagtggaaaacaccgctaagttgaccaattta
gcctggtttctcgatacaaatcggttaactcaagaattgggtattttgtcaatttcccta
attaatgactttgcggctgttggttatggcatttttgggttaacaaaacaggatttacta
actttacaagttggtaaatatcaaccagcagcaccaatggctgtaatcggtgcaggaact
ggattaggccagggatttttgattaaacaggatcatcaatatcaagtctttccttccgag
ggtggacacgcagattttgccccccggaatgagttagaatttcaactgttgaaatatctg
gtagataaacataatattcaacgagtttctgtagaaagagtggtttccgggttaggaatt
acctccatttaccaatttttacgagataggaaaatagccaccgaatcaccagaaattgcc
caagcagtcagaacttgggaacaagaagccggaaaagccgaaaaaaccattgatcctggg
gcatttattgggagtgcggcgctggaaaaaagcgatcgcctttccgaacaaaccatgcaa
ttatttgtagaagcctacggtgccgaagccggcaatctagccctcaaactcctcccctat
ggcggattatacattgctggtggtatcgctcccaaaatcctccctttaatgcaaaatggt
agtttcctcacgaattttacccaaaaagggagaatgggttctttactggaagaaataccc
gtgcatataattcttaatcaacaagttggattaattggtgcagctttgtctgcctctagg
ttataa

DBGET integrated database retrieval system