KEGG   Anabaena sp. 90: ANA_C11408Help
Entry
ANA_C11408        CDS       T02341                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
anb  Anabaena sp. 90
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ANA_C11408 (folE)
Enzymes [BR:anb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ANA_C11408 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:1553235..1553882
Genome map
AA seq 215 aa AA seqDB search
MTLSIRPELNSTADISSLYQQELPTVTEADMRQAVRTLLIGLGENPDREGLKDTPKRVVK
ALKFLTSGYDQSIDELLNGAVFTEDANEMVLVRDIDLFSSCEHHILPIIGRAHIAYIPNG
KVIGLSKIARICEMYARRLQVQERLTLQIANALQGLLKPQGVAVVIEATHMCMVMRGVQK
PGSWTVTSAMRGVFSEDARTREEFMNLIRHSANFK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgactttatctattcgtccagagctaaattctactgctgacatttcatccttatatcag
caagaattaccaactgtaacagaagctgatatgagacaagctgtacgcactttgttgatt
ggattgggagaaaatccagaccgtgagggattaaaagatactcccaaaagagttgttaaa
gcgttaaaatttcttacaagtggatatgatcaatctatagatgaactgctaaatggagca
gtatttacagaagatgcaaatgaaatggttttagtccgggatattgatcttttcagttcc
tgtgaacaccacatattaccaatcattggccgcgctcatatcgcttatattcctaatggt
aaagtcataggattatcaaaaattgcccgcatttgtgaaatgtatgctcgacgtttacaa
gtgcaagaacggctgactttacaaattgctaatgcactgcaaggtttactcaaacctcaa
ggggttgcagtggtaattgaagcaactcatatgtgtatggtgatgagaggagtgcaaaaa
ccaggttcttggactgttaccagtgctatgcgtggtgtgttttctgaagacgcacgcact
cgtgaagaatttatgaatttaattcgccacagtgctaattttaaatag

DBGET integrated database retrieval system