KEGG   Anabaena sp. 90: ANA_C11556Help
Entry
ANA_C11556        CDS       T02341                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
anb  Anabaena sp. 90
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:anb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:anb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:1697686..1698192
Genome map
AA seq 168 aa AA seqDB search
MPLISLIAAISENRILSDSTKEHIHAGIPWNIPSDELYYRETIRRHPVIIGRKSYATFNK
PIRNCTTIILTRDTNFQAFGCVVLHSLPEAIAWAKMSETEEIFIAGGGQIYTEAIKLADK
LYLTIVEGNFVGDIYFPEFADFGKVTKEKKMQENGFKFNFVEIEKCVN
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgattagtctcattgctgccatttctgaaaatcgaattttatcagactcgaca
aaagaacatattcatgcgggtattccttggaatattcccagtgatgaactttattatcgg
gaaactatccgacgacatcctgtcattatcgggcgcaaaagttatgccacttttaataaa
ccaattcgtaattgtacaactatcattcttaccagagacaccaattttcaagcctttggt
tgtgtagttttgcattcattaccagaagcaattgcatgggcgaaaatgagtgaaacagaa
gaaatatttatcgctggtggtggacagatttacactgaagcaatcaaattggccgataaa
ctttatttaaccattgttgaaggtaattttgtgggagacatatactttcctgaatttgcc
gattttggaaaagtcaccaaagagaagaaaatgcaggaaaatggctttaagtttaatttt
gtggaaattgaaaagtgcgttaattag

DBGET integrated database retrieval system