KEGG   Anabaena sp. 90: ANA_C11722Help
Entry
ANA_C11722        CDS       T02341                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase HemD (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
anb  Anabaena sp. 90
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:anb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:complement(1877206..1878003)
Genome map
AA seq 265 aa AA seqDB search
MNYNLSPLTGKTILVTRSVGQSHQFSDRLTFAGANVIEMPALEIGPPSSWDALDQAISHL
STFNWLILTSSNGVEYFFERLEKSGQDKNALAGVKIAVVGEKTAQSLQKQNIQANFIPPN
FVADSLVENFPESLTGKKILFPRVESGGREVLVKELTAKGAEVIEVPAYESCCPQSIPPA
AEYALVNNTVDIITFASSKTVLFFSQLTAHIFTYNPENLARVCIASIGPQTSKTCQTVFG
RVDIEAEEYTLEGLTNAIIKWTNHS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaattacaatctttctcctttaactgggaaaaccattttagttacccgttctgtggga
caatcgcaccaatttagcgatcgcttaaccttcgcaggtgctaatgtgatagaaatgcca
gctttagaaattggaccccctagcagttgggacgctttagatcaggcaatttcacattta
tcaacttttaattggttaattctcacttctagtaatggtgtggaatacttttttgagaga
ttagaaaaatccggtcaagataaaaatgctttagctggtgtaaaaattgccgttgttggg
gaaaaaaccgcccaaagtttacaaaaacaaaatattcaagctaactttattcctcctaac
tttgtggctgattctttagtggaaaactttcccgaatcactaacaggtaaaaagatatta
tttcctagagttgaaagtggtggaagagaagtattagtaaaggaattaacagctaaaggt
gcagaagtaattgaagttcccgcttatgaatcttgctgtcctcaaagtatcccccctgcg
gctgaatatgccttagttaataatactgtagatattattacttttgccagttctaaaaca
gtcttatttttctcgcaattaacagcacatatatttacctacaatccagaaaatttagcc
agagtttgcatagcttccattggtccccaaacttcaaaaacctgtcaaactgtatttggg
agagtagatattgaagcggaagaatataccttagaaggtttaacaaatgccataattaaa
tggacaaatcatagctga

DBGET integrated database retrieval system