KEGG   Anabaena sp. 90: ANA_C11968Help
Entry
ANA_C11968        CDS       T02341                                 

Definition
beta-glucosidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
anb  Anabaena sp. 90
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ANA_C11968
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ANA_C11968
Enzymes [BR:anb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     ANA_C11968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:2178972..2181359
Genome map
AA seq 795 aa AA seqDB search
MTNHPQIPPCTWKRPIGLGWENPYTVRYPSNIDDGPWHGMPLGGFGAGCIGRSSRGDFNL
WHIDGGEHTFKTVPACQFSIFESGQAYALSTQPPEDHTLQSWQWYPQSQEQNSGTYHALY
PRSWFVYENVLKTQLTCEQFSPIWADNYQESSYPVAVFLWKAHNPTNAPITISIMLTWEN
MVGWFTNTLKSPEVRVRDDGSPVYEYLPRWGESQGNYNCLAEDHQYFGCVLGQVSDHQTV
QEGDGTWCIATAKNPQVEIFYHSRFNPVGNGEDVWQSFSANGSLPNYIDETPADENTRLG
AAIAVRFTLQPGENLEVPLVLSWDFPVTEFAAGVNYYRRYTDFFGCNGENAWQIATTALK
EYQNWRSLIQDWQNPILAKSDLPDWFKMALFNELYDLTSGGTLWSAASEIDPVGQFAVLE
CLDYRWYESLDVRLYGSFGLLMLFPELEKSVIRAFARAIPQSDDRTRIIGYYLTIKSESP
NAVRKIAGATPHDLGAPNEHVWEKTNYTSYQDCNLWKDLGCDFVLQVYRDFLFTGANDLQ
FLADCWDAIVQTLDYVKTFDLDGDSIPENSGAPDQTFDDWRLQGVSAYCGGLWLAALEAA
IAISKILTNRRGAEDAEVEVQGSIYQGWLSQSKPIYQEKLWNGEYYRLDSDSGSDVVMAD
QLCGQFYARLLSLPDIVPSDRALSALTKVYDSCFLKFQNGEFGAANGVLPNGLPENPNST
HPLEVWTGINFGLAAFLVQMNMKNEAMRLTEAVVRQIYDNGLQFRTPEAITANGTFRAST
YLRAMAIWGIYLLVR
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccacccacaaattcccccctgcacctggaaacgtcccattggcttaggctgg
gagaacccctacaccgtccgttatcccagtaatattgatgatggtccctggcacggaatg
ccccttggtggctttggtgcagggtgtataggacgttcttcacggggagactttaacctg
tggcacattgacgggggagaacatacttttaaaactgttcccgcttgtcaatttagtatt
tttgaatctggacaagcttacgcattatctacccaacctccagaagatcatacactgcaa
tcttggcaatggtatccacagtctcaggaacagaattcaggtacatatcacgcactttat
ccccgcagttggtttgtttatgaaaatgtcttaaaaactcaattaacctgtgagcaattt
tcgccaatttgggcagataattatcaagaatcaagttatccggttgcggttttcttgtgg
aaagcacacaaccccacaaatgcaccaattaccattagcattatgctaacttgggaaaat
atggtcggttggtttactaatactttaaaatctcccgaagttagagttagagatgatgga
agtcctgtttatgaatatctaccacgctggggagaaagtcaaggaaattataattgttta
gcagaagatcatcaatattttggttgtgttttaggtcaagtttctgatcatcaaactgtc
caagaaggagacggaacttggtgtattgcgactgctaaaaatccccaagtggaaatattc
tatcattcccgatttaatcctgtgggtaatggtgaagatgtttggcaaagtttctctgca
aatggttctttacctaattatatagatgaaactcccgcagatgaaaataccagattaggt
gcagcaattgcggtgcgtttcactttgcaacctggggaaaatttagaagttcccttggtg
ctaagttgggattttcccgttacagaatttgcagcaggagtgaactattaccgcagatat
acagacttttttggttgtaatggtgagaatgcttggcagattgccactactgctcttaaa
gaatatcagaattggcgatcgctcattcaagattggcaaaatcccattttggcaaaatca
gatttacctgactggttcaaaatggctttatttaacgaactctacgatttaaccagtgga
ggaactctctggagtgcggcctcagaaattgatcccgttggtcaatttgccgtgttagaa
tgtttagattatcgttggtatgaaagtttagatgtgcggttatacggttcttttgggtta
ttgatgttattccctgaattggaaaaatcggtaattcgggcttttgctagggcaattccc
caaagtgatgatagaactagaataatcggttattatttaactatcaaatctgaaagtccc
aacgcagttcggaaaattgccggtgcgacaccccacgatttaggcgcacccaatgaacac
gtttgggaaaaaaccaattatactagttatcaagattgcaacctgtggaaagatttaggt
tgtgatttcgttttgcaggtatatcgagattttctgtttaccggtgcaaatgatcttcaa
tttttagcagattgttgggatgctattgtccaaactctcgattatgtgaaaacttttgat
ctcgatggtgacagtataccagaaaattctggcgctcctgaccaaacttttgatgattgg
cgtttacaaggtgtgagtgcttattgtggtggtttgtggttagctgctttggaagctgct
attgctatttctaagattttaacgaaccgcagaggcgcagaggacgcagaggtggaggtg
caagggtctatttatcaaggttggttaagtcaatcgaagccaatttatcaggagaagctt
tggaatggtgagtattaccgtttggatagtgacagtggttctgatgtagttatggctgac
caattgtgtgggcaattctacgctcgtttattgagtttaccagatattgttccgagcgat
cgcgctttgtctgccttaacaaaagtatatgattcctgttttctcaagtttcaaaatggt
gaatttggcgctgctaatggtgttcttcccaatggtttacccgaaaatcccaattctact
catcctttggaagtttggacgggaatcaattttggtctagcagctttcctggtgcaaatg
aacatgaaaaatgaggcaatgcggttaactgaggctgtggtgaggcaaatttacgacaat
ggtttgcaatttcgcaccccggaagcaatcaccgctaatggcactttccgcgctagtacc
tatctccgcgctatggctatttggggaatctatttgctagttcgttaa

DBGET integrated database retrieval system