KEGG   Anabaena sp. 90: ANA_C12027Help
Entry
ANA_C12027        CDS       T02341                                 

Gene name
bchI
Definition
(GenBank) magnesium chelatase BchI
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
anb  Anabaena sp. 90
Pathway
anb00860  Porphyrin and chlorophyll metabolism
anb01100  Metabolic pathways
anb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ANA_C12027 (bchI)
Enzymes [BR:anb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ANA_C12027 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 AAA_16 MCM Sigma54_activat AAA_29 AAA DUF815 TIP49 AAA_18 ABC_tran AAA_28 AAA_27 AAA_30 MMR_HSR1 RNA_helicase tRNA_lig_kinase AAA_7
Motif
Other DBs
NCBI-ProteinID: AFW94777
UniProt: K7W134
Position
chANA01:complement(2272590..2273708)
Genome map
AA seq 372 aa AA seqDB search
MTSTAQASASARRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIPVVANDPFNSDPNDTDLMSDEVRQQVAQGLEIPITHKKVQMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPAKFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEERGEFDQNP
PVYLEKHQAPQVALQEKIVNAQNLLPQVNLDYDFRVKISEVCSELDVDGLRGDIVTNRAA
KALTAFEGRTEVTIDDIRRVITLCLRHRLRKDPLESIDTGYKVEKVFCRVFGVELPEDST
QKNGAGMKAGAR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcaactgctcaagctagtgcgagtgcgcgtcgtgcggtcttcccatttacagcc
atcgtcggtcaagaagaaatgaaactggcactgctgttaaatgtcattgaccccaaaatt
ggtggtgtaatgattatgggcgatcgcggcaccggaaaatctacaactatccgcgccttg
gcggaccttttaccagaaatccctgttgtcgccaatgaccccttcaacagtgaccccaac
gacacggacttgatgagtgatgaagtccgtcaacaggtagcacaggggttagaaattccc
atcactcacaaaaaggtgcaaatggtagatttaccattgggcgctacagaagaccgcgtt
tgtgggacaattgacattgaaaaagccttatctgagggtgtcaaagcttttgaaccggga
ctcctagccaaagccaaccggggtattctctacgttgatgaggtcaacttgttagatgac
cacttggtagacgtactcctcgattccgctgctagtggctggaataccgtggaacgggaa
ggaatttctatccgtcaccctgcgaagtttgttctcgttggttcaggaaatcctgaagaa
ggggaattacgtcctcaacttctcgaccgttttggaatgcacgcggaaattcataccgtt
aaagaaccagctttacgggtacaaattgtggaggaacggggtgaatttgaccaaaatccg
cctgtgtatttagaaaaacaccaagcaccacaagtagcattacaagagaaaattgtcaat
gcccaaaacttattaccacaagttaatttagactatgacttccgggtgaaaatttccgaa
gtttgttcagaattagatgtggacgggttgcggggtgacatcgtgacgaaccgtgcggct
aaagccttgacagcttttgaaggtcggacagaagttacaattgacgatatccgtcgggta
attactttatgtctgcgtcaccgtttgcggaaagatcctttagaatctattgatactggc
tataaagtggaaaaggtcttttgtcgggtttttggtgtggaacttccagaagattcaacc
cagaaaaatggtgcagggatgaaagctggcgctcgttag

DBGET integrated database retrieval system