KEGG   Anabaena sp. 90: ANA_C12457Help
Entry
ANA_C12457        CDS       T02341                                 

Definition
CheR methyltransferase with PAS sensor
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
anb  Anabaena sp. 90
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:anb02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:anb02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:2760066..2761961
Genome map
AA seq 631 aa AA seqDB search
MNVPQKDPDFENLLEYLRINRGFDFTGYKRSTLMRRVTKEMETLNIDTFGNYQDYLEVHP
DEFKNLFNTILINVTAFFRDASAWEYLAKEVIPNIIKNKQPDQQIRFWSAGCASGQEAYT
LAIVIAEILGIEEFRNRVKIYATDVDEEALVQARQASYSTKNIDEVPLELRDKYFDIVNK
NYVFRQDLRRCVIFGRHDLLQDAPISRLDLLICRNTLMYFNSETQGKIINRFHFALNDHG
YLFLGKAEMLVMHSNLFIPIDLKDRVFEKVALGNFRSRQIVMNNLENQESTTDLSQEIRI
RDLAFDTASSAQVVVDNDGILIMINEQARNLFGLTTKDLNRPFQDLELSYRPVELRSVIE
QVYNERHPITLTNVERYQSNSEIQNLDVRVIPLQDNNQIILGVTVAFNDITRYLKLQTAL
QRSRQELETTNEELQSTNEELETTNEELQSTNEELETTNEELQSTNQEMETMNEELQSAN
EELQTINHELSDRTSELDQSNIFLSSILGCLQMGMVVLDNNLNILIWNHTVEDMWGLHSE
EVVHKSWFSLDIGLPVEKLRNPIRDIMSGKKKFQEILLNGTNRRGRQIQCYIACSPLMNE
TVKGVIIMMTDIEKINSMISPTKIEERQREG
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcccacagaaagaccctgattttgaaaacctcctcgaatatttacgaatcaac
cgaggctttgatttcacaggttataaacgttcaactttaatgcgccgtgttacgaaagaa
atggagactttaaatatagatacttttggcaattatcaagattatttagaagttcatcca
gatgagtttaaaaatttatttaatactattttaattaacgtcaccgctttttttagagat
gcttcagcgtgggaatatttagccaaagaagttattcctaatatcatcaaaaataaacaa
ccagatcaacagattcgattttggagtgctggttgtgcttctgggcaagaagcttatact
ttagcaatagtaatagcggaaatattgggaatagaagagtttcgtaatcgggtaaaaatc
tacgcaacagatgtagatgaagaagctctcgttcaagctcgtcaagctagttattcaacc
aaaaatattgatgaagtcccgttagaattacgcgataaatattttgatatagtcaataaa
aattatgtttttcgccaagatttgcgtcgttgtgtaatttttggtcgtcatgatttactt
caagatgcaccgatttctcggttagatttattgatttgtcgcaataccttaatgtatttt
aattcggaaacccaaggaaagattatcaatcgctttcattttgctcttaatgatcatggc
tatctgtttttaggaaaagcagaaatgctagttatgcactctaatttatttatccctata
gatttaaaagaccgtgtatttgaaaaagtagctttaggaaacttccgcagtcgtcaaata
gttatgaacaatttagaaaatcaagaatcaactactgatttgtctcaagaaatacgcatt
agagatttggcttttgatacagcatctagtgcccaagttgtagtagataatgatggcata
ttaattatgattaatgaacaagctcgtaatttatttggtctgacaacaaaggatttaaat
cgcccttttcaggatttagaattatcctatagacctgtggaattacgctcagtaattgag
caagtatataatgaacgtcatccgattacactcacaaatgttgaacgttatcagtctaat
tcagaaattcaaaatttagatgtgcgggtgattcctttacaagataataatcaaattatt
cttggtgtaacagttgcctttaatgatatcacccgttatctgaaactccaaacagcatta
caacgttctcgacaggaactagaaacaaccaatgaagaattgcaatcaactaatgaagag
ctagaaacaaccaatgaagaattacaatctaccaatgaagaattagaaacaaccaatgaa
gaattgcaatcaacaaatcaagaaatggagacaatgaatgaagaactgcaatcggctaat
gaggagttacaaacaattaatcatgaattaagcgatcgcaccagtgaacttgaccaaagt
aatatttttctttcttctattttaggctgtctgcaaatgggaatggtagtcttagataat
aacttgaatattttaatttggaatcatacagttgaagatatgtggggtttacacagtgag
gaagtagttcataaatcttggtttagcttggatattggtttacctgtagaaaaattgcga
aatccaattcgtgatattatgtccggtaaaaagaagttccaggaaatactccttaatggc
actaatcgtcgcggcagacaaatccaatgttatattgcctgtagtcccctaatgaatgaa
acagtaaaaggtgttattatcatgatgacagatattgaaaaaatcaacagtatgatttct
ccaacaaaaattgaagaaagacaacgggaaggataa

DBGET integrated database retrieval system