KEGG   Anabaena sp. 90: ANA_C12677Help
Entry
ANA_C12677        CDS       T02341                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
anb  Anabaena sp. 90
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ANA_C12677 (glgB)
Enzymes [BR:anb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ANA_C12677 (glgB)
Exosome [BR:anb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ANA_C12677 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:3020789..3023080
Genome map
AA seq 763 aa AA seqDB search
MSTTTVAPEQVNRIVGNQHHDPFEILGSHLIEQNGKTVWAVRAYLPNASAAWVVVPEERK
EYPMDTVHNPHFFECTIETPELKNYQLRIKEGEHERVVNDPYAFRSAHLTEFDLHLFSEG
NHHRIYEKLGAHTTEVDGVKGVYFAVWAPNARNVSLLGDFNLWDGRKHQMRKGHTGIWEL
FIPEIGVGEHYKYEIKNFEGHIYEKSDPYGFQQEPRPKTASIVTDLNSYTWKDEDWLEKR
RHSDPLSQPISVYEVHLGSWLHAASAEPAKLPNGETEAVVVVSELKPGARFLTYRELADK
LIPYVKKLGYTHLELLPIAEHPFDGSWGYQVTGYFAPTSRFGTPEDFMYFVDECHNNGIG
VIVDWVPGHFPKDGHGLAFFDGSHLYEHSDSRKGEHKEWGTLVFNYNRHEVRNFLVANAL
FWFDKYHIDGIRVDAVASMLYLDYCREPGEWLPNEYGGRENLEAADFLRQVNSLLFSYYP
GVLSIAEESTSWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNITFSM
WYNHSENFMLALSHDEIVHGKSNIIGKMPGDEWQKLANIRCLFAYMFAHPGKKTMFMSME
FGQWSEWNAWADLEWHLLQFEPHRQLKDFFQSLNLFYRSEPALYTQDFDQAGFEWIDCTD
NRHSVVSFVRRDKNSDDFMIVVCNFTPQPHSHYRIGVPEKGFYTELFNSDARQYGGSNMG
NLGGKWTDDWSLHNRPYSLDLCLPPLGVLMLKLDKQKSAQVME
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaaccacagtcgcccctgaacaggttaatcgcattgttggcaatcaacatcac
gatccctttgaaattctgggttctcatctcatcgagcaaaatggtaaaactgtctgggct
gtgcgagcctatctcccaaatgccagcgctgcgtgggtagtagttccagaagaacggaaa
gaataccccatggatacagtgcataatccacacttttttgaatgcaccattgaaacccca
gaactaaaaaattatcagttacgcattaaagaaggggaacatgagcgagtggttaatgat
ccctacgctttccgttctgcccacttaacagaatttgatctacatttatttagtgaaggc
aaccatcaccgcatttacgagaaattgggagcgcacaccacagaagtagatggtgtcaaa
ggcgtttattttgccgtttgggcccccaatgcccgcaacgtttccttattgggagatttt
aacctgtgggatggacgcaaacaccagatgcggaaaggacacacaggcatttgggaatta
tttattcccgaaatcggtgtaggagaacattacaaatacgaaatcaaaaattttgaaggg
catatttacgaaaaatccgatccctacggtttccagcaagaaccccggccaaaaaccgca
tctattgtcactgacttaaattcctacacctggaaagacgaagactggctggaaaagcgg
cgacacagtgaccccttgagtcaacccatttccgtttacgaagtccatttaggttcttgg
ttacacgctgctagtgctgaacctgccaaattacccaatggggaaactgaagctgtagtt
gtcgtttctgaactaaaacccggcgctcggtttctgacttatcgggaactagcagataaa
ctcattccctacgttaagaaattaggatatacccatttagaactcctcccaattgccgag
catccctttgatggttcttggggttatcaagtaaccggttattttgcgcctacttcccgt
tttggtacacccgaagacttcatgtactttgtggacgaatgccataacaatggtattggt
gtcattgtagactgggttcctggccacttccccaaagatggacatggtttagctttcttt
gatggtagtcacttgtatgaacattctgattcccgcaaaggtgaacataaggaatggggg
actttagtatttaactacaatcgccatgaagtccgtaatttcttggtggctaatgccctg
ttctggtttgataaataccacattgacggaattcgggttgatgcggttgcttccatgctc
taccttgattattgccgagaaccaggagaatggttgcctaacgaatacggtggtcgagaa
aatttagaagctgctgattttttacgtcaagttaatagcttgttatttagttattatcct
ggtgtgctttccattgcggaggagtccacatcttggccaatggtatcttggcctacctat
acgggcggattgggctttaacttaaagtggaatatgggctggatgcacgatatgctggat
tacttcagcatggacccctggtttcgccagttccatcaaaacaatattacctttagtatg
tggtataaccacagcgagaacttcatgttagctctctcccatgatgaaatcgtccatggt
aagagtaatatcatcggcaaaatgcccggtgatgaatggcagaagttagctaatatccgc
tgtttgtttgcttatatgtttgctcaccctggcaagaaaaccatgtttatgagcatggaa
tttggccagtggagtgagtggaatgcttgggctgatttggaatggcatcttttacagttt
gaaccacaccgacagttaaaggattttttccagtctcttaatcttttttaccgttctgaa
ccagctttatatactcaagattttgaccaagcggggtttgagtggattgattgtactgat
aaccgtcatagtgtggtttcttttgtccgtcgtgacaagaattctgacgattttatgatt
gtggtttgtaattttacacctcaaccccattcgcactaccgtattggtgttcctgaaaag
ggtttttatacagagttgttcaatagtgatgctcgtcagtatggcggtagcaatatgggc
aatttaggtggtaagtggactgatgattggtctttgcacaatcgtccttattctttggat
ttgtgtttacctcctttgggtgtgttgatgctcaagttggataaacagaagtcagcacag
gtgatggaataa

DBGET integrated database retrieval system