KEGG   Anabaena sp. 90: ANA_C12791Help
Entry
ANA_C12791        CDS       T02341                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
anb  Anabaena sp. 90
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:anb00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:complement(3145756..3147432)
Genome map
AA seq 558 aa AA seqDB search
MVIGVIKAKSFSRRGAEARREEGNFFWDVIYVGCESVPVLPQNMIAGISAGGFSDAFDVW
VRVEEDRLILGREAFGRVSLFWTRQGGVLWFASQLQLLLEVIEKPEVNISGLYGYSCFSY
VPNPLTPVNEVFSVPAGTEIIWEDVDNPQFRSIYQWCESKSQIQDENTAVSQLQVLLKNS
IQKQISNLRDEPVGVFLSGGLDSSIVAALLVEAGIKVRAYSLDFGNVGISEYPYAEQVAK
FLNIPLVKVDASPGKIKQALIPTIKALDLPFGDGVTVPLYLLNQVASQETQVIFNGEGGD
QLFAGWTNKPLIAAGIYQSEHPDKEESFIHQYLRTFHRLWGYESRVYQPEIYAQIQGLNA
QEWLLNALDASFCPSLLHRLRRASLMLKGAQNIHPRATALGFAHGLGVRSPFCDLLLAEW
TFQLSGELCLNGACEKYILKRAAENWLPSEIVWRQKRGMGVPLTSWCLNDYWHDLGNWLN
PGILKSDGCFFPDIASQIVTGELGGQIQGRRIGESLWLLIMWQLWHYHVFGSKLGKKSLS
HPFILPRWLWKKLQQSQI
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
ttggttattggggtgataaaagcaaagagtttctcacgcagaggcgcagaggcgcgaaga
gaggaaggaaattttttttgggatgttatttatgttggttgtgagtctgtacctgtgtta
ccgcaaaatatgattgcgggtatttctgctgggggattttctgatgcttttgatgtttgg
gtaagggtagaggaagataggttaattttgggtagggaagcttttggacgagtttcttta
ttttggactcgacaaggtggggtgctttggtttgcttctcaattacaattacttttagaa
gttatagaaaaaccggaagttaatatttctggtttatatggttatagttgtttttcttat
gttcctaatcctctgactcctgttaatgaggtgttttctgtacctgcgggaactgagatt
atttgggaagatgttgataatccccaatttcgtagtatttatcaatggtgtgaatcaaag
tcacaaattcaagatgaaaatacagcagtttctcaattacaagttttactgaaaaattct
attcaaaaacagatttctaatttaagagatgaacctgtgggggtttttctgtctgggggt
ttggattcttctattgttgcggctttgttggtagaagctgggataaaagttcgtgcttac
tctttggattttggtaatgtgggaatttctgaatatccctatgcggaacaagttgcaaag
tttctgaatattcctttagttaaagttgatgctagtcctggtaagattaaacaggctcta
attcctactatcaaagctttagatttaccttttggtgacggtgtgactgttcctttatat
ctcctcaatcaagttgctagtcaagaaactcaagtgatttttaatggtgaaggtggtgat
caattatttgccggttggactaataaacctttaattgctgcgggtatttatcaatctgaa
catcctgataaagaagaaagttttattcaccaatatctgcggacttttcaccgtttgtgg
ggttatgaatctagggtgtatcagccggaaatatatgctcagattcaaggtttaaatgct
caggaatggttgttaaatgctcttgatgctagtttttgtccttcgttgttacatcgtctc
cgtcgtgccagtttgatgttaaaaggagcgcaaaatattcatccccgtgcgactgcgttg
ggttttgctcatgggttaggtgtgcgatcgcccttttgtgatttacttttagcagaatgg
acttttcagctatctggggaactctgtctaaacggtgcttgtgagaagtatatcctcaaa
cgagcagcagaaaattggctaccttcagaaatagtttggcgacaaaaacgcggtatgggt
gttcccttaacctcttggtgtttaaatgattattggcatgatcttggtaattggttaaat
cctggtatactaaaatcggatggctgtttttttcctgatattgcgtcacaaattgttaca
ggtgaactaggaggacaaattcaaggacgacgaattggtgaaagtctgtggttattgata
atgtggcaactttggcattatcatgtttttggttctaaattaggcaaaaagtctttatct
catccatttattttacctcgatggttatggaaaaagttacagcaatcccaaatttag

DBGET integrated database retrieval system