KEGG   Anabaena sp. 90: ANA_C12794Help
Entry
ANA_C12794        CDS       T02341                                 

Definition
magnesium chelatase ATPase subunit (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
anb  Anabaena sp. 90
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ANA_C12794
Enzymes [BR:anb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ANA_C12794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:3148328..3150352
Genome map
AA seq 674 aa AA seqDB search
MRSPTLTPTMTAFPLAAVVGQEAIKIALLLTAVDPVLGGVVIAGRRGTAKSVMARAIHAL
LPPIEVVKGSVSNCDPNHPEEWDDKLLAGQRQEIETEIIPAPFLQIPLGITEDRLLGSVD
VEQSVKQGDTIFQPGLLATANRGVLYVDEINLLDDQISNQLLSVLSDGRNQIEREGISFQ
HPCKTLFIATYNPEEGALREHLLDRIAIALSADGVLGIDQRVQAVEQAIAYSQSPTEFLQ
QYSEDIDSLKTQIILAREWLKEVTITQEQITYLVNEAIRGGVEGHRAELFAVRVAKAAAA
LEGRSTVTAEDLRRAVELVIVPRTTIIQTPPDEQQPPPPPPPPQENQDESESEEEQEEEQ
EEEKEEDQEQQEPPDIPEEFIFDPEGVILDPEVLYFTQMAQKQGKSGSRSIIFSDDRGRY
IKPMIPKGKARRIAVDATLRAAAPYQKARRARQPDKKVIVEQGDIRSKRLVRKAGALVVF
VVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVSLIPFRGEQAEVLLPPTRSIALAKNR
LERLPCGGGSPLAHGLTQAVRVGINAQMGGDIGQVVIVAITDGRGNIPLARSLGEPMEPG
EKPDIKAELLDIAGRIRASGMQLLVIDTESKFVSTGFAKELSKTAGGKYYHLPKATDKAI
AAMTRGAIADMKAK
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcgcctactcttaccccgacaatgactgcttttcccttggctgctgtagttggt
caagaagcaattaaaatagctttgctgttgacagcagtagatcccgttttggggggtgtg
gtaattgcaggtcgtcgcggtacggctaaatctgtgatggcgcgggctattcacgcttta
ttaccacctattgaagttgtcaaaggttctgttagcaactgtgaccccaaccaccccgaa
gaatgggatgataaacttttagcgggacaaagacaggagatagaaacggaaattatccct
gcaccttttttgcagattcctctggggattacggaagaccggcttttaggttctgtggac
gtggaacagtcggttaaacaaggtgatacaatttttcaaccgggattactcgctacagcc
aatcgtggtgtgctgtatgtggatgaaatcaatttattagatgaccaaattagtaaccaa
cttttatcggtattatcggacggacgtaaccaaattgaacgggaaggaatcagttttcaa
catccttgcaaaactttgtttattgccacttataatccagaagaaggagcgctcagagag
catttacttgatagaatagcgatcgccctatcagcagacggagttctgggtatagatcaa
agagtacaggcagttgaacaagcgatcgcctattcccagtctcccacagaatttctgcaa
caatacagcgaagatatagactcactcaaaacccaaatcatcctggcacgggaatggtta
aaagaagtcaccattacccaagaacaaattacctacctcgtcaatgaagccattcgcggg
ggtgtagaaggacatcgggcagaattatttgcagtgcgcgtagccaaagccgcagcagcc
ttagaaggacgcagtaccgtcaccgctgaagatttacgtcgcgcagtggaattggtgata
gttcccagaaccacaattattcaaactccaccagacgaacagcaaccaccaccacctccc
ccaccaccacaagaaaatcaagacgagtcggaatcagaagaagaacaagaggaagaacag
gaagaagagaaagaagaagaccaagaacagcaagaacccccagacattcccgaagaattt
atctttgatccagaaggggtaattctcgacccggaagtgctttattttacccaaatggca
caaaagcagggtaaatctggaagtcgcagtattatcttctcagacgataggggacggtac
attaagccgatgattcccaaaggtaaagcgagaagaatagccgtagatgccacactgcga
gccgcagccccatatcaaaaagcacgccgggctagacaacctgataaaaaggtgattgtc
gaacagggagatatccgttctaagcggttagtgagaaaagccggtgcgttggtggtgttt
gttgtagatgcttctggttcaatggctttaaatcggatgcaatccgctaaaggtgcggtg
atgcagcttttgacagaagcgtatcaaaatcgtgatcaagtatctttgatccccttccga
ggagaacaagcggaagttttattacctcctacccgttccattgctttagctaagaatagg
ttagaaagattaccctgcggtggtggttctcctttagcacatggtttaactcaagcggta
cgggtggggataaatgcccaaatgggtggggatatcgggcaggttgtgatagtggcaatt
actgatggacgcggtaatattcctttagctcgttctttaggtgaacccatggaaccagga
gaaaaaccagatatcaaagccgaattattagatattgccggcagaattcgggcttcaggg
atgcagttgttggtaattgatacggaaagtaagtttgtatccactggctttgcgaaggaa
ttatcaaaaacagccggaggtaaatattatcacttaccaaaagcgacagataaagcgatc
gcagcgatgacgagaggtgctatagcagacatgaaagcaaaatag

DBGET integrated database retrieval system