KEGG   Anabaena sp. 90: ANA_C12944Help
Entry
ANA_C12944        CDS       T02341                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
anb  Anabaena sp. 90
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:anb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:complement(3311136..3311777)
Genome map
AA seq 213 aa AA seqDB search
MISYLKGIVAGVQAITPNRVILTLEVNGTGYDLQIPQRLSNQLTSTGDVIQIFTHYQIRE
EIPMLYGFSSPSERDLFRHLLSVSGIGAALAIALLDTMELPELVQAIVAANIQMLIQAPG
VGKKTAERICLELKSKLIEWRKSAGFFVATGGPAPGILEEVQMTLFALGYTAHEVSHALH
TVSENIGLPKNAYVEDWIRQAIAYLSSSEVECS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgattagctatcttaaaggtatcgttgctggtgtccaagccattactcctaatcgcgtc
atcttgaccttagaagtcaatggcacaggttacgatttacaaattccccaacgtttgtcc
aaccagttaacatctactggggatgtgatccaaatctttacccattaccagattcgagag
gaaatccccatgctttatggtttttcttctccttccgaacgggatttatttcgccatttg
ctcagtgttagcgggattggtgcggcattagcgatcgctctcttggatacaatggaatta
ccagagttagtccaagccattgtcgctgctaacatccaaatgctaattcaagcccctgga
gtgggcaagaaaaccgctgaacgcatttgtttagaactaaagagtaaactcatcgaatgg
cgcaaatcagcgggcttctttgtggctacagggggacccgcaccaggaattttagaagaa
gtgcaaatgactctctttgctttgggatatactgcccatgaagtcagtcacgctttgcac
acagttagcgaaaatattggtttacccaaaaatgcctatgtggaagattggattagacaa
gcgatcgcttatcttagcagtagtgaagtagagtgttcctaa

DBGET integrated database retrieval system