KEGG   Anabaena sp. 90: ANA_C13296Help
Entry
ANA_C13296        CDS       T02341                                 

Gene name
phoA
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
anb  Anabaena sp. 90
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:anb00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:anb00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:anb02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:3738637..3740412
Genome map
AA seq 591 aa AA seqDB search
MVIKSSSQFRFKRRLFTTVLIIVVGIFITLTNHSSPATPVTKTKNVILMIGDGMGWEMAR
AGAMAKGYNYTSGKGEGLSFQTLDNYALATTYGTTIAPGNGVFSTGNSALSNSNPITGAS
PILPGFKFQPQFNPGDKPSGGGKNLNPNAVGNLVGYDPQRGGINPWTPGNDPEYIKYSYP
DSANTATTLYTGVKSYNNAISVDIFEKPLETILKTAADHGKSTGIVTSVPVDHATPGAAA
ANVNRRNKYDGDYPTLDNILQQELRIYQPTVILGGGHPLTGASSQPLPTGVEPPTKFEYI
TKTTYAELSKNPNQNRYNYTFLERGKDAADKLATTAAKLDPNMGDRLLGLYGARGQEGNL
PVSTANGDYSNTGLSNFSLFSSQGQKPDTVRPLLAGETDQSFIAKEINENPTLDDLTKAA
LAVLSKDKDGFWLMVEGGDIDWAAHDDNIDNMIGTVLDFDKAVKTTIDWIKNNGGWENNL
LIVTADHDHYLTLNPNFSELLKEKSAEALTAESDSMKAGHFWGSNPQIKYGWGNHGNRPV
PVYYQGKGAEVLTNSVGKGFRLYGDDIPGIGGLVDQIHIYQTQRKAIGNRE
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggtaattaaatctagttcacaattccgatttaaacgccgtttatttactacagtgttg
atcattgtagttggtatattcatcactctgactaaccattctagccccgctacacctgtc
actaaaaccaaaaacgtcattctgatgattggggatggtatgggctgggaaatggctcgc
gctggggctatggctaaaggatataattatacttctggtaagggggaaggactgagtttt
caaactctggataattacgcccttgctaccacctatggtactaccattgctcctggtaat
ggagttttcagcacgggtaactctgcgttatcaaactctaatccgattacaggcgctagt
ccgattctaccagggtttaaattccaacctcaatttaatcctggcgataaaccatctgga
ggggggaaaaatcttaatcctaatgcggtaggtaatttagtgggttatgatcctcaacgt
gggggaataaatccttggacaccgggtaatgatcctgagtatattaagtatagttatcct
gattctgccaatacggcaactactttgtacacaggagtcaaaagctataacaatgctatt
tccgttgatatatttgaaaaacctttagaaactattctcaagactgcggctgatcatggt
aaatctactgggattgtcacttctgttcctgtagatcatgctacacctggtgcagcagca
gcaaacgtgaatcgtcgcaataaatatgatggtgattatccaactttagataatattctc
cagcaggaacttcgcatatatcaaccaactgtaattttaggtggtggtcatcctctcacg
ggtgcgagtagtcaacctctgcctacgggtgtagaaccgccaactaaatttgaatatatc
actaaaacgacctatgcagaattgagtaaaaaccccaatcaaaaccgctataactacaca
tttttagaacggggaaaagatgcggctgataagttagcgactactgcggctaaattagat
ccaaatatgggcgatcgcttgttaggattatatggagctaggggacaagagggaaatctc
cctgtaagtaccgcaaatggagattacagtaatacaggtttaagtaatttttctttgttt
agttcccaaggacaaaaacctgatacagttcgtcctctacttgctggagaaaccgatcaa
tcttttattgcgaaagaaattaatgaaaatcccacacttgatgatttaaccaaagcagct
ttagcagttttatctaaagacaaagatggattttggttaatggtagaaggtggtgatatt
gattgggctgcccatgatgataatatagataatatgattgggacagtgttggattttgac
aaagctgtaaaaacgacaattgactggattaaaaataatggtggttgggaaaataatctg
ttgattgttactgctgatcatgatcattatctgactttaaatcccaacttttctgaacta
ctcaaagaaaaaagtgcagaagctttaactgctgaatctgattccatgaaagcgggtcat
ttttggggttctaatcctcagattaaatatggttggggaaatcatggtaatcgtccagtt
cctgtttattatcaaggtaaaggtgcagaagttttaactaattctgtcggtaagggtttt
cggctttatggtgatgatattcctggtattgggggtttagtagaccaaattcacatttat
cagactcaacggaaagcaatagggaatagggaatag

DBGET integrated database retrieval system