KEGG   Anabaena sp. 90: ANA_C13331Help
Entry
ANA_C13331        CDS       T02341                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
anb  Anabaena sp. 90
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANA_C13331 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANA_C13331 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ANA_C13331 (thrC)
Enzymes [BR:anb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ANA_C13331 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:complement(3786368..3787462)
Genome map
AA seq 364 aa AA seqDB search
MTLSLSAAKSHCQPWPGLIEAYRQYLPVSEKTPVVTLLEGNTPLIPVPAIAERIGRQVKV
YVKYDGLNPTGSFKDRGMTMAISKAAEAGAKAVICASTGNTSAAAAAYARRGGMKPFVLI
PDGYVALGKLAQALLYGAEVLAIQGNFDRALEIVREMADQYPITLVNSVNPYRLEGQKTG
AFEVVDALGDAPDWLCIPVGNAGNITAYWMGFCQYHQDGKCDRLPKMMGFQAAGAAPLVN
GQPVAHPETIATAIRIGNPASWDKAIAAQTASQGSFRSVTDEEILDAYRLLASSEGIFCE
PASAASVAGLLQVKDEVPTGATVVCVLTGNGLKDPDTAIKHSHAQFKQGIPADIKAVAKA
MGFD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgagcctgtctgctgctaaatctcattgccaaccctggccagggctgatagaa
gcctatcgtcaatacttgcctgtcagcgaaaaaaccccggtggtgactttgttggagggt
aacacacctttgattcccgtgccagcgatcgctgaacgtattggcagacaggtgaaggtg
tatgtcaaatatgatggacttaaccccactggtagcttcaaagaccgggggatgaccatg
gcaatttctaaagcagcagaagcaggtgctaaggctgtgatttgtgccagcactggtaat
acctccgccgctgccgctgcctatgctagacgggggggaatgaaaccctttgtgttgatt
cctgatggctatgtggctttaggtaaattagcccaagcgttactttatggggctgaagtc
ctggctattcaaggaaattttgaccgcgccctggaaattgtccgggaaatggcagatcaa
tatcccatcactttggtaaattctgtcaacccctaccggttagaagggcaaaaaactgga
gcttttgaagttgttgatgccttgggtgatgcccccgattggttatgtattcccgtgggg
aatgcgggcaatattacagcatattggatgggtttttgtcaataccatcaagatggtaaa
tgcgatcgcttgccgaaaatgatgggtttccaagccgctggggctgcacccttagtaaat
ggtcaaccagtggcacatcctgaaaccatagccacagccattagaattggtaatcccgcc
agttgggataaagccatagccgctcaaacagccagccaaggcagtttccgttctgtcact
gacgaggaaattctcgacgcttaccgactattagcatcatcggaagggattttctgtgaa
cctgccagcgcggcttctgtcgccggtttgttacaggtaaaagacgaagttcccaccggg
gcaacggtagtctgtgtcctcactggtaatggtttaaaagacccagatacagccattaaa
cacagtcacgcccaatttaaacagggtattccggcggacattaaggccgttgcgaaagca
atgggatttgattaa

DBGET integrated database retrieval system