KEGG   Anabaena sp. 90: ANA_C13334Help
Entry
ANA_C13334        CDS       T02341                                 

Definition
arginase (EC:3.5.3.-)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
anb  Anabaena sp. 90
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ANA_C13334
Enzymes [BR:anb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ANA_C13334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:complement(3791001..3792056)
Genome map
AA seq 351 aa AA seqDB search
MNKPLQEYNPNSVAEKNGNFLGLPDDYDSANLIIFPIPWEVTVSYRAGTANGPQRILDAS
LQIDLFDFDHPDGWKQGIFMVEIPQEMIEKNNYYRQQAARIIERQAQGKSLTDSPDLTSV
LEAINQAGEQVNHWLLTQSQAAMNQGKRVAVIGGDHSSPLGYFQALANQYDDWGILHIDA
HADLRNAYEEFEFSHASIMFNAIKIPQISKLVQVGVRDICHDEVQIINQSNDRIIGYYDS
AIKQQLYAGKNWLDLCREIINHLPEKVYISFDIDGLDPKLCPNTGTPVPGGLELEQVYCL
FRELVNSGREIIGFDVCEVGDAEWDGNVGARIVYKLANLLDLSQKEGTGNR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccactacaagaatacaatcccaacagtgtagccgaaaagaatggtaacttc
ctcggattacctgatgattacgattcagccaatttaattatcttccccataccttgggaa
gtcaccgtttcatatcgtgcgggaactgcgaacggaccacagcgaattttagatgcctca
ctgcaaatagatttatttgattttgatcatcccgacggttggaaacagggaatatttatg
gtagaaattccccaggaaatgatcgaaaaaaataactattatcgtcaacaagcagccaga
attattgaacgtcaagcccaaggtaaatccctaacagattcaccagatttaacctctgtt
ctagaagcaattaaccaagctggggaacaggtaaatcattggttattgacccaatcacaa
gcagcaatgaatcaaggtaaacgagttgctgtcattggtggtgatcacagttcaccatta
ggctacttccaagccttagctaatcaatatgatgactggggaattttacatattgatgcc
catgcagacttacgtaatgcctatgaggaatttgaattttctcatgcgtctattatgttt
aatgccataaaaataccgcaaatttctaaattagtccaagtaggtgtacgggatatttgt
cacgatgaagtgcaaatcattaatcaatcaaatgatcgcattattggttattatgattca
gcaattaaacaacaactatatgctggtaaaaattggttggatttatgtcgagaaattatc
aaccatttaccagaaaaagtttatattagcttcgacattgatggtttagatcctaaactt
tgccccaatacaggtactcctgttcctggaggactggaattagaacaagtttattgtttg
ttccgcgaactggtaaatagtggtagagaaattattggttttgatgtctgcgaagttggt
gatgctgaatgggatggtaatgttggtgcgcgaatagtttacaagttagcaaatttatta
gatttatctcagaaagagggaacaggtaataggtaa

DBGET integrated database retrieval system