KEGG   Anabaena sp. 90: ANA_C13711Help
Entry
ANA_C13711        CDS       T02341                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
anb  Anabaena sp. 90
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ANA_C13711 (malQ)
Enzymes [BR:anb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ANA_C13711 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:4184090..4185598
Genome map
AA seq 502 aa AA seqDB search
MPFPRSSGILLHPSSFPSRFGIGDLGLEAYRFIDFLKHSHQQYWQVLPLGPTGYGNSPYM
CYSAMAGNYFLISPEKLLDEGLLIPEDLADLPDFSVNKVDFNEVIPIKVNLLIKACEDFK
TKANSTQKAAFAKFCADKGYWLNNYALFMAIKDAQKGKSWHNWQPELAKREPAALAKITQ
ELKEEIFYYKFVQYEFFRQWSELKKYANENGIEIIGDIPIYVAHDSADVWANPEIFALDE
ETGEVALMAGVPPDYFSSTGQLWGNPVYNWEELQKQDFKWWILRFEAMLDYVDIIRIDHF
RGFEAYWAVPQGETTAMNGEWIEAPGVALFEAIRKRLGKLPVLAEDLGIITPEVEALRDQ
FEFPGMKVLQFAFGSDPGNPFLPFNYTRNAVVYTGTHDNDTTVGWFNTGNDYEKQNLLLY
LGCISPDGIHWDLIRLALSSIANQAIIPLQDVLGLGTEARMNFPSTAEGNWEWRYQPGVL
TPDLSDRLKTLTLRYGRASREK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcctagatccagtggtattttacttcatcctagttcttttcccagtcggttt
ggtattggggatttgggtttggaagcttatcggtttattgattttctcaaacatagtcat
cagcaatattggcaagttttacctctaggtccgactggttacggtaattccccttatatg
tgctactccgcaatggcgggaaattactttttgattagtcccgaaaagttgctagatgag
ggtttgttaattccagaagatttggctgatttaccagatttttctgtaaataaagtagat
tttaacgaagttatccctattaaggttaatctactcattaaagcttgtgaggattttaaa
actaaagcaaattcaactcaaaaagcagcttttgctaagttttgtgctgataaaggctat
tggttaaataattacgcgctatttatggcgattaaagatgcccaaaagggtaaaagctgg
cataattggcaaccggaattagcaaagcgtgaaccagcagctttagcaaaaattacacaa
gagttaaaagaggagattttttattacaagtttgttcaatatgagttcttccggcagtgg
tcagaactgaaaaaatatgctaacgaaaatgggatagagattattggtgatattcccatt
tacgtagcccatgatagtgctgatgtgtgggctaatcctgagatttttgctttagatgaa
gaaacgggagaagtggctttaatggcgggagttccacccgactactttagctctactggt
caattatggggaaatccggtttataactgggaagaattgcaaaaacaagatttcaaatgg
tggatattacgctttgaggcgatgctggattacgtggatataattcgcattgatcatttc
cggggttttgaggcttattgggctgttccccagggagaaactactgccatgaatggcgaa
tggattgaagcgcctggagtggctttatttgaggcaattagaaagcgtttgggtaagtta
cctgttttggcggaggatttgggaattattacgccagaagtggaggcactgcgagatcag
tttgagtttccagggatgaaggtgttacagtttgcctttggttctgatcccggaaatcca
tttttaccttttaattacactcgtaatgctgtagtttatacaggtactcacgacaacgat
acgactgtaggctggtttaacacgggaaatgattatgaaaagcaaaatttattgttgtat
ttgggttgtataagtcctgatggtatacactgggacttaattagattagctttaagttcg
atcgctaatcaagcgattatacctttgcaggatgtattaggtttgggaactgaagcccgg
atgaattttcctagtacagcggagggaaattgggagtggcgttaccaaccaggtgtatta
acgccagatttaagcgatcgcttaaaaactctcactctccgttacggacgcgctagtaga
gaaaagtag

DBGET integrated database retrieval system