KEGG   Anabaena sp. 90: ANA_C13722Help
Entry
ANA_C13722        CDS       T02341                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
anb  Anabaena sp. 90
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ANA_C13722
   00330 Arginine and proline metabolism
    ANA_C13722
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ANA_C13722
Enzymes [BR:anb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ANA_C13722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA01:complement(4197882..4198796)
Genome map
AA seq 304 aa AA seqDB search
MLGIKSINIHNLSSWVEQSKTQAAQGKVIERIPQLAIVNPNRFAVHISCEPGENYSLGDT
ACVFPFMSVIKPFSLLYLLEYYGVKQVLQWVGVKSSDAPFNSLVQLIADNGYPRNPMINS
GAITLADKLPGKDGNECTQLFCEWLNKLADTQLYIDANILASVRASSSQTNIDITNYLYE
AGHLNNIELSLDVYEQICCISGTVEDLAKLGKVLACKSEVIKNQHRQIVNAVMLTCGLYE
ASAEYAVKIGLPIKSGIGGGLVAIIPNQGAIASYSPALDIVGNPVAGLALMETLSQSLQL
SIFS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgctaggaataaaaagcattaatatacataatttatctagctgggtagaacaatcaaaa
acccaagcagcacagggaaaagttattgaacgcattcctcaattagctattgttaatcct
aaccgttttgctgttcatataagttgcgaaccaggagaaaattacagtttaggagataca
gcttgtgtatttccatttatgagtgtgataaagccattttctctactatacctgctcgaa
tattacggagtaaaacaggttttgcaatgggttggggttaaatcctcggacgcgcctttt
aattctttagtgcaattaatagcagataatggatatcctcgcaaccccatgattaatagt
ggtgctattactctcgctgataagttgccaggaaaagatggaaatgaatgtacacaattg
ttttgtgaatggttaaataaattagcagatactcaattatatatagatgcaaatattcta
gcttcagtccgtgctagtagttctcagacaaatatagatattactaactatctctacgaa
gctggacatttaaataatattgaattatctcttgatgtttatgagcaaatatgttgtata
tctgggacagtggaagatttagcgaagttaggaaaagtattagcttgcaaaagcgaggtg
atcaaaaatcaacaccgtcaaattgtgaatgcggtgatgttaacttgcggtttatatgaa
gcttccgctgagtatgctgtgaaaattggtttaccaataaagtcaggtattggtggtgga
cttgtggccatcataccaaatcagggagcgatcgccagctacagtcctgctttagacatt
gtaggtaatcctgtagctggtttggcactaatggaaactttatctcaaagtttgcaactg
agtatttttagttaa

DBGET integrated database retrieval system