KEGG   Anabaena sp. 90: ANA_C20202Help
Entry
ANA_C20202        CDS       T02341                                 

Definition
type 1 fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
anb  Anabaena sp. 90
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:anb01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:anb01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA02:234120..234935
Genome map
AA seq 271 aa AA seqDB search
MTIATSKPPINWVNTLFFVSLHVGALFALIPSNFSWKAIGVALLLYWVTGGLGITLGYHR
LVTHRSFQTPKWLEYVLVIFGTLSCEGGPIEWVGTHRIHHLHSDTESDPHDSNQGFWWSH
MGWMIHFAPAHSQVPRFTKDIIDDPVYQFLQKNFILLQVALGIILYFLGGWPMVVWGIFA
RIIWVYHCTWLVNSATHKFGYRTYDSGDQSTNCWWVAILVFGEGWHNNHHAFQYSARHGL
EWWEIDLTWMTIQLLQLLGLATNVKLAEKKA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgctacttctaaacctcccattaactgggttaataccctatttttcgtttca
ttgcacgtcggcgctctatttgccttaattccgagcaattttagctggaaggcaattggt
gttgctttattgctttactgggtgactggaggtttaggtattactttgggatatcaccgt
cttgtcactcaccgtagttttcaaacgcctaaatggctagagtatgtcttggtaatcttt
gggacactatcttgtgaaggtggtccaattgaatgggtaggtacacatcgaattcaccac
ttacattctgatactgaatctgatccccatgattcaaatcaaggtttctggtggagtcac
atgggttggatgattcattttgctcctgctcacagtcaagttcctcgcttcactaaagac
attattgatgacccagtttatcagtttttacagaaaaatttcattttattacaagttgcc
ttgggcataatcctatatttcttaggtggctggccaatggtagtttggggaatttttgcg
cggattatttgggtttatcactgtacttggttggtaaatagtgctactcataaattcgga
taccgcacttatgattctggtgaccagtcaactaattgttggtgggttgccattctcgtt
tttggtgaaggctggcacaataaccaccatgcgtttcaatactctgcccgtcatggtttg
gaatggtgggaaattgatctgacttggatgacaattcagttattacaattactaggtcta
gcgacaaacgtaaagctggcagagaaaaaggcataa

DBGET integrated database retrieval system