KEGG   Anabaena sp. 90: ANA_C20202Help
Entry
ANA_C20202        CDS       T02341                                 

Definition
type 1 fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
anb  Anabaena sp. 90
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ANA_C20202
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ANA_C20202
Enzymes [BR:anb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ANA_C20202
Lipid biosynthesis proteins [BR:anb01004]
 Desaturase
  First
   ANA_C20202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA02:234120..234935
Genome map
AA seq 271 aa AA seqDB search
MTIATSKPPINWVNTLFFVSLHVGALFALIPSNFSWKAIGVALLLYWVTGGLGITLGYHR
LVTHRSFQTPKWLEYVLVIFGTLSCEGGPIEWVGTHRIHHLHSDTESDPHDSNQGFWWSH
MGWMIHFAPAHSQVPRFTKDIIDDPVYQFLQKNFILLQVALGIILYFLGGWPMVVWGIFA
RIIWVYHCTWLVNSATHKFGYRTYDSGDQSTNCWWVAILVFGEGWHNNHHAFQYSARHGL
EWWEIDLTWMTIQLLQLLGLATNVKLAEKKA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgctacttctaaacctcccattaactgggttaataccctatttttcgtttca
ttgcacgtcggcgctctatttgccttaattccgagcaattttagctggaaggcaattggt
gttgctttattgctttactgggtgactggaggtttaggtattactttgggatatcaccgt
cttgtcactcaccgtagttttcaaacgcctaaatggctagagtatgtcttggtaatcttt
gggacactatcttgtgaaggtggtccaattgaatgggtaggtacacatcgaattcaccac
ttacattctgatactgaatctgatccccatgattcaaatcaaggtttctggtggagtcac
atgggttggatgattcattttgctcctgctcacagtcaagttcctcgcttcactaaagac
attattgatgacccagtttatcagtttttacagaaaaatttcattttattacaagttgcc
ttgggcataatcctatatttcttaggtggctggccaatggtagtttggggaatttttgcg
cggattatttgggtttatcactgtacttggttggtaaatagtgctactcataaattcgga
taccgcacttatgattctggtgaccagtcaactaattgttggtgggttgccattctcgtt
tttggtgaaggctggcacaataaccaccatgcgtttcaatactctgcccgtcatggtttg
gaatggtgggaaattgatctgacttggatgacaattcagttattacaattactaggtcta
gcgacaaacgtaaagctggcagagaaaaaggcataa

DBGET integrated database retrieval system