KEGG   Anabaena sp. 90: ANA_C20238Help
Entry
ANA_C20238        CDS       T02341                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
anb  Anabaena sp. 90
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANA_C20238 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANA_C20238 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ANA_C20238 (thrC)
Enzymes [BR:anb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ANA_C20238 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA02:273034..274338
Genome map
AA seq 434 aa AA seqDB search
MTQAITNLNQANTSILKALKCKECGAEYELKATHVCELCFGPLEVKYDYNVLRSLVSRET
IEAGPNSIWRYRHFLPVATDDYIDVGTGMTPLVRSHRLARRLGLNKLYIKNDAVNMPTLS
FKDRVVSVALSRARELGFTTVSCASTGNLANSTAAIAAYAGLDCCVFIPSDLEAGKVIGS
LIYSPTLMSVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLAFEVAEQLGWQL
PDHIVAPLASGSLFTKIYKGFQEFVEVGLVEGKDVRFSGAQAEGCSPIAKAFKEGRDFIQ
PVKPNTIAKSIAIGNPADGVYAVEIAQKTNGNIESVNDAEIIEGIKLLAETEGIFTETAG
GTTVAVLKKLVEAGKIDPDETTVVYITGNGLKTQEAIQGYIGEPLTIDAKLDSFERALER
SRTLDRLEWQEVTV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcgattacaaacctcaaccaagcgaacacttctattctcaaggctttgaag
tgtaaagaatgtggagcagaatacgaacttaaagccactcatgtatgtgaattgtgtttt
ggaccgttggaagtcaaatatgattacaatgtgctgcggagtttagttagtcgagaaact
attgaagctggtcccaattctatctggcgctatcgtcactttttgccagttgctacagat
gattatatagatgtgggaacaggaatgactcccttggtgcgttcccaccgtcttgcccgt
cgcctgggtctaaataaactttatattaaaaatgatgccgtcaatatgcccaccctgagc
tttaaggatcgggtggtgtcagttgccctcagtagagcgagagaattgggttttacgact
gtttcttgtgctagtacaggtaatttagcaaattctaccgcagcgatcgccgcctacgct
ggtttagattgctgtgtatttatcccttctgacttagaagctggtaaagtcatcggtagc
ttgatttatagtcctaccctgatgtcagtcaaaggcaactatgatcaagttaatcgtctt
tgctcagaagttgccaatacccacggttggggttttgtgaatattaacctgcgtccttac
tactctgaaggttctaagacattagcctttgaagttgcagaacaactaggttggcaatta
ccagatcatatagttgcccctttggcttctggttctctgtttaccaaaatttataaaggt
ttccaagaatttgtcgaagttggtttggtagaaggtaaagatgttcgctttagtggcgct
caagcggaaggttgttcccccattgcgaaagcttttaaagaaggtagagactttattcaa
ccagttaaacctaacacaattgctaaatccattgcgattggcaatcctgccgatggtgta
tatgctgtagaaatcgctcaaaaaaccaacggtaatattgaatcagttaatgatgccgaa
attatcgaaggtatcaaactattggcagaaaccgaaggtatctttaccgaaaccgcaggt
ggtacaaccgttgctgttcttaaaaaattagtagaagctggcaaaattgatccagatgaa
actacagtggtttatatcactggcaatggtttgaaaacccaggaagcaattcaaggctac
attggtgaacctttaacaattgatgccaaactagacagttttgaacgggctttagaaaga
tcccgcacacttgaccgcttagaatggcaagaagttacagtttaa

DBGET integrated database retrieval system