KEGG   Anabaena sp. 90: ANA_C20238Help
Entry
ANA_C20238        CDS       T02341                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
anb  Anabaena sp. 90
Pathway
anb00260  Glycine, serine and threonine metabolism
anb00750  Vitamin B6 metabolism
anb01100  Metabolic pathways
anb01110  Biosynthesis of secondary metabolites
anb01120  Microbial metabolism in diverse environments
anb01230  Biosynthesis of amino acids
Module
anb_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANA_C20238 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ANA_C20238 (thrC)
Enzymes [BR:anb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ANA_C20238 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NinF
Motif
Other DBs
NCBI-ProteinID: AFW96689
UniProt: K7WA11
Position
chANA02:273034..274338
Genome map
AA seq 434 aa AA seqDB search
MTQAITNLNQANTSILKALKCKECGAEYELKATHVCELCFGPLEVKYDYNVLRSLVSRET
IEAGPNSIWRYRHFLPVATDDYIDVGTGMTPLVRSHRLARRLGLNKLYIKNDAVNMPTLS
FKDRVVSVALSRARELGFTTVSCASTGNLANSTAAIAAYAGLDCCVFIPSDLEAGKVIGS
LIYSPTLMSVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLAFEVAEQLGWQL
PDHIVAPLASGSLFTKIYKGFQEFVEVGLVEGKDVRFSGAQAEGCSPIAKAFKEGRDFIQ
PVKPNTIAKSIAIGNPADGVYAVEIAQKTNGNIESVNDAEIIEGIKLLAETEGIFTETAG
GTTVAVLKKLVEAGKIDPDETTVVYITGNGLKTQEAIQGYIGEPLTIDAKLDSFERALER
SRTLDRLEWQEVTV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcgattacaaacctcaaccaagcgaacacttctattctcaaggctttgaag
tgtaaagaatgtggagcagaatacgaacttaaagccactcatgtatgtgaattgtgtttt
ggaccgttggaagtcaaatatgattacaatgtgctgcggagtttagttagtcgagaaact
attgaagctggtcccaattctatctggcgctatcgtcactttttgccagttgctacagat
gattatatagatgtgggaacaggaatgactcccttggtgcgttcccaccgtcttgcccgt
cgcctgggtctaaataaactttatattaaaaatgatgccgtcaatatgcccaccctgagc
tttaaggatcgggtggtgtcagttgccctcagtagagcgagagaattgggttttacgact
gtttcttgtgctagtacaggtaatttagcaaattctaccgcagcgatcgccgcctacgct
ggtttagattgctgtgtatttatcccttctgacttagaagctggtaaagtcatcggtagc
ttgatttatagtcctaccctgatgtcagtcaaaggcaactatgatcaagttaatcgtctt
tgctcagaagttgccaatacccacggttggggttttgtgaatattaacctgcgtccttac
tactctgaaggttctaagacattagcctttgaagttgcagaacaactaggttggcaatta
ccagatcatatagttgcccctttggcttctggttctctgtttaccaaaatttataaaggt
ttccaagaatttgtcgaagttggtttggtagaaggtaaagatgttcgctttagtggcgct
caagcggaaggttgttcccccattgcgaaagcttttaaagaaggtagagactttattcaa
ccagttaaacctaacacaattgctaaatccattgcgattggcaatcctgccgatggtgta
tatgctgtagaaatcgctcaaaaaaccaacggtaatattgaatcagttaatgatgccgaa
attatcgaaggtatcaaactattggcagaaaccgaaggtatctttaccgaaaccgcaggt
ggtacaaccgttgctgttcttaaaaaattagtagaagctggcaaaattgatccagatgaa
actacagtggtttatatcactggcaatggtttgaaaacccaggaagcaattcaaggctac
attggtgaacctttaacaattgatgccaaactagacagttttgaacgggctttagaaaga
tcccgcacacttgaccgcttagaatggcaagaagttacagtttaa

DBGET integrated database retrieval system